Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4R6W8

Protein Details
Accession F4R6W8    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
105-136RPIARFPQARPLPKRRQPKKPSPFGRRIRMPKBasic
NLS Segment(s)
PositionSequence
113-136ARPLPKRRQPKKPSPFGRRIRMPK
Subcellular Location(s) nucl 15, mito_nucl 12.833, mito 9.5, cyto_nucl 8.833
Family & Domain DBs
KEGG mlr:MELLADRAFT_101770  -  
Amino Acid Sequences MPQLTLSRSRFVVGSVLQSLAPKSRSKKQQSSDSDAHRTAEDSLPLPEDTESEDIHVDPHFNINILKRYNAQCSNKKPFREPPVSENFSQRVIMEYEQVDTDDERPIARFPQARPLPKRRQPKKPSPFGRRIRMPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.18
3 0.19
4 0.18
5 0.19
6 0.19
7 0.19
8 0.2
9 0.22
10 0.26
11 0.34
12 0.44
13 0.53
14 0.61
15 0.64
16 0.72
17 0.74
18 0.77
19 0.75
20 0.72
21 0.68
22 0.6
23 0.53
24 0.43
25 0.36
26 0.3
27 0.25
28 0.19
29 0.14
30 0.14
31 0.15
32 0.14
33 0.14
34 0.11
35 0.1
36 0.11
37 0.11
38 0.11
39 0.09
40 0.1
41 0.09
42 0.1
43 0.1
44 0.08
45 0.06
46 0.08
47 0.07
48 0.07
49 0.09
50 0.1
51 0.15
52 0.15
53 0.16
54 0.18
55 0.2
56 0.26
57 0.32
58 0.36
59 0.38
60 0.46
61 0.55
62 0.57
63 0.57
64 0.57
65 0.58
66 0.6
67 0.61
68 0.56
69 0.52
70 0.56
71 0.57
72 0.53
73 0.5
74 0.42
75 0.35
76 0.33
77 0.26
78 0.18
79 0.17
80 0.16
81 0.14
82 0.13
83 0.13
84 0.12
85 0.13
86 0.11
87 0.1
88 0.11
89 0.11
90 0.11
91 0.11
92 0.11
93 0.12
94 0.13
95 0.18
96 0.22
97 0.2
98 0.31
99 0.39
100 0.47
101 0.55
102 0.63
103 0.69
104 0.73
105 0.83
106 0.81
107 0.85
108 0.86
109 0.89
110 0.89
111 0.9
112 0.92
113 0.91
114 0.92
115 0.9
116 0.9