Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4EED9

Protein Details
Accession A0A0C4EED9    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
110-132IPKVCCCQKMGREKKGRKKMRNKBasic
NLS Segment(s)
PositionSequence
120-132GREKKGRKKMRNK
Subcellular Location(s) nucl 8, plas 7, pero 4, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPVARVQKSLEQPDKSLNLIDRQHGDDVDDLRSAYLGWRPPASKRGNKTLAKSNHFKLGNLLSAGDDEWMQAHQNLRRPHPAMPHSGSPLVTCTGFVLFLSAKLFFSSFIPKVCCCQKMGREKKGRKKMRNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.45
3 0.41
4 0.34
5 0.33
6 0.32
7 0.34
8 0.31
9 0.32
10 0.32
11 0.28
12 0.27
13 0.23
14 0.22
15 0.2
16 0.17
17 0.14
18 0.12
19 0.12
20 0.11
21 0.09
22 0.11
23 0.13
24 0.14
25 0.17
26 0.19
27 0.22
28 0.3
29 0.36
30 0.4
31 0.41
32 0.49
33 0.55
34 0.58
35 0.59
36 0.6
37 0.6
38 0.59
39 0.59
40 0.51
41 0.5
42 0.47
43 0.42
44 0.36
45 0.3
46 0.26
47 0.22
48 0.2
49 0.12
50 0.12
51 0.11
52 0.09
53 0.06
54 0.04
55 0.04
56 0.04
57 0.05
58 0.06
59 0.09
60 0.11
61 0.18
62 0.21
63 0.24
64 0.3
65 0.32
66 0.34
67 0.38
68 0.39
69 0.39
70 0.39
71 0.39
72 0.36
73 0.35
74 0.32
75 0.25
76 0.23
77 0.18
78 0.14
79 0.11
80 0.09
81 0.08
82 0.08
83 0.08
84 0.08
85 0.07
86 0.08
87 0.09
88 0.09
89 0.09
90 0.1
91 0.1
92 0.09
93 0.11
94 0.17
95 0.17
96 0.2
97 0.24
98 0.24
99 0.29
100 0.35
101 0.35
102 0.32
103 0.38
104 0.43
105 0.51
106 0.61
107 0.66
108 0.71
109 0.79
110 0.87
111 0.9
112 0.92