Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4DUT3

Protein Details
Accession A0A0C4DUT3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
131-159AERIRRAPETRKGRQRREKPRPNRVGEGGBasic
NLS Segment(s)
PositionSequence
133-161RIRRAPETRKGRQRREKPRPNRVGEGGGK
Subcellular Location(s) mito 21.5, cyto_mito 12.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021056  Mt_import_IM_translocase_Tim54  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF11711  Tim54  
Amino Acid Sequences MATSQKPSEGNRALRMMGLPALPKRLPSRNWLIFWAVATTTSAAIIYDRREKRRATARWAHAVSHLAKEPLARPTDMPRRLTIYLESPPGDGFRVAQDHFLEYIKPILAASGLDWDFVQGRQQGDVRAVVAERIRRAPETRKGRQRREKPRPNRVGEGGGKLSNSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.38
3 0.3
4 0.24
5 0.2
6 0.19
7 0.18
8 0.23
9 0.22
10 0.26
11 0.3
12 0.35
13 0.36
14 0.39
15 0.47
16 0.48
17 0.5
18 0.49
19 0.45
20 0.39
21 0.37
22 0.31
23 0.21
24 0.15
25 0.14
26 0.12
27 0.09
28 0.08
29 0.07
30 0.06
31 0.06
32 0.08
33 0.11
34 0.19
35 0.25
36 0.3
37 0.34
38 0.35
39 0.42
40 0.5
41 0.52
42 0.52
43 0.56
44 0.57
45 0.62
46 0.62
47 0.55
48 0.47
49 0.45
50 0.37
51 0.3
52 0.26
53 0.17
54 0.16
55 0.16
56 0.16
57 0.17
58 0.16
59 0.14
60 0.14
61 0.22
62 0.31
63 0.34
64 0.34
65 0.3
66 0.34
67 0.34
68 0.34
69 0.27
70 0.21
71 0.19
72 0.19
73 0.19
74 0.14
75 0.14
76 0.13
77 0.12
78 0.09
79 0.08
80 0.07
81 0.1
82 0.1
83 0.11
84 0.11
85 0.12
86 0.13
87 0.13
88 0.11
89 0.09
90 0.1
91 0.08
92 0.08
93 0.07
94 0.06
95 0.06
96 0.06
97 0.05
98 0.09
99 0.09
100 0.09
101 0.09
102 0.1
103 0.11
104 0.11
105 0.14
106 0.11
107 0.12
108 0.14
109 0.15
110 0.16
111 0.17
112 0.17
113 0.15
114 0.13
115 0.12
116 0.12
117 0.15
118 0.17
119 0.18
120 0.21
121 0.23
122 0.25
123 0.29
124 0.35
125 0.42
126 0.49
127 0.56
128 0.64
129 0.72
130 0.8
131 0.86
132 0.89
133 0.91
134 0.92
135 0.93
136 0.93
137 0.94
138 0.94
139 0.9
140 0.87
141 0.8
142 0.77
143 0.71
144 0.67
145 0.59
146 0.51