Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RNA5

Protein Details
Accession F4RNA5    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
130-154LTVPTTNKKKGRKCKGKAPVAKTQGHydrophilic
161-184ASGGLTRRPPKKSRKGRVEVSSIVHydrophilic
NLS Segment(s)
PositionSequence
137-177KKKGRKCKGKAPVAKTQGRPRGSGASGGLTRRPPKKSRKGR
Subcellular Location(s) mito 13, nucl 8, cyto_nucl 8, cyto 6
Family & Domain DBs
KEGG mlr:MELLADRAFT_87440  -  
Amino Acid Sequences MTERKAFPRLTPTILAPPQIPTAGNILVGFFVLDPIYIYKTKMLPPSSSLVPSSNGPTLRPRTPTQPRPDFIIQSPDLCVASICPSPIRETVDSDNEASVWEVTSGESNTTDGIGGDKVEVVEESDNNNLTVPTTNKKKGRKCKGKAPVAKTQGRPRGSGASGGLTRRPPKKSRKGRVEVSSIVLCSYFKNSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.42
3 0.34
4 0.32
5 0.3
6 0.28
7 0.25
8 0.17
9 0.18
10 0.17
11 0.17
12 0.14
13 0.12
14 0.11
15 0.11
16 0.09
17 0.05
18 0.06
19 0.05
20 0.05
21 0.05
22 0.06
23 0.1
24 0.1
25 0.11
26 0.14
27 0.16
28 0.21
29 0.27
30 0.28
31 0.26
32 0.29
33 0.32
34 0.32
35 0.31
36 0.28
37 0.23
38 0.22
39 0.21
40 0.21
41 0.21
42 0.19
43 0.19
44 0.24
45 0.28
46 0.3
47 0.33
48 0.32
49 0.38
50 0.48
51 0.55
52 0.58
53 0.61
54 0.58
55 0.61
56 0.61
57 0.54
58 0.46
59 0.44
60 0.35
61 0.28
62 0.27
63 0.21
64 0.18
65 0.15
66 0.14
67 0.07
68 0.09
69 0.09
70 0.09
71 0.09
72 0.09
73 0.11
74 0.13
75 0.16
76 0.14
77 0.17
78 0.19
79 0.22
80 0.22
81 0.2
82 0.18
83 0.15
84 0.14
85 0.11
86 0.08
87 0.05
88 0.04
89 0.04
90 0.04
91 0.05
92 0.05
93 0.06
94 0.06
95 0.06
96 0.06
97 0.06
98 0.06
99 0.04
100 0.05
101 0.05
102 0.05
103 0.05
104 0.05
105 0.04
106 0.05
107 0.05
108 0.05
109 0.06
110 0.06
111 0.08
112 0.09
113 0.09
114 0.09
115 0.1
116 0.09
117 0.09
118 0.11
119 0.12
120 0.18
121 0.24
122 0.32
123 0.39
124 0.48
125 0.57
126 0.66
127 0.74
128 0.79
129 0.79
130 0.82
131 0.85
132 0.87
133 0.86
134 0.82
135 0.8
136 0.78
137 0.78
138 0.74
139 0.74
140 0.72
141 0.65
142 0.6
143 0.53
144 0.51
145 0.45
146 0.41
147 0.32
148 0.29
149 0.29
150 0.29
151 0.3
152 0.3
153 0.36
154 0.4
155 0.46
156 0.49
157 0.57
158 0.67
159 0.74
160 0.79
161 0.83
162 0.86
163 0.88
164 0.87
165 0.83
166 0.75
167 0.69
168 0.61
169 0.5
170 0.41
171 0.32
172 0.25
173 0.19