Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1D8PJ53

Protein Details
Accession A0A1D8PJ53    Localization Confidence Low Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
50-69KLQQQHKKFIQQKQNIHQSNHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 7, golg 5, mito 4, pero 4, E.R. 4, nucl 1, cyto 1, cyto_nucl 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR031459  Coa2  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
KEGG cal:CAALFM_C301090WA  -  
Pfam View protein in Pfam  
PF17051  COA2  
Amino Acid Sequences MFQYIKATQRNRLTNSLFSSTFAICVLLVGANSAIPCPVDSNYSNDSNEKLQQQHKKFIQQKQNIHQSNKENEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.57
3 0.53
4 0.44
5 0.38
6 0.35
7 0.28
8 0.24
9 0.19
10 0.14
11 0.09
12 0.08
13 0.07
14 0.05
15 0.05
16 0.04
17 0.04
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.04
24 0.05
25 0.05
26 0.08
27 0.09
28 0.14
29 0.17
30 0.19
31 0.2
32 0.2
33 0.21
34 0.2
35 0.23
36 0.22
37 0.23
38 0.29
39 0.38
40 0.42
41 0.5
42 0.52
43 0.6
44 0.64
45 0.69
46 0.71
47 0.71
48 0.76
49 0.76
50 0.83
51 0.8
52 0.77
53 0.75
54 0.73