Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8X062

Protein Details
Accession L8X062    Localization Confidence High Confidence Score 23.2
NoLS Segment(s)
PositionSequenceProtein Nature
14-36KSDSENKARKYNKKSNPDEPGVQHydrophilic
234-265VSANTASKSEKPKKPKLQEKPKKSKSAPLAFQHydrophilic
NLS Segment(s)
PositionSequence
9-27IKRNGKSDSENKARKYNKK
75-117KAEMRRKERKMAMRYHKQKVNRKIAQTKRALEAPDLDKKERKK
226-258KAPSNRHRVSANTASKSEKPKKPKLQEKPKKSK
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019310  Efg1  
Gene Ontology GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF10153  Efg1  
Amino Acid Sequences MPPLRHRNIKRNGKSDSENKARKYNKKSNPDEPGVQKVKSAIRQTRRLLAKESLAADVRIASERRLKSLEADLAKAEMRRKERKMAMRYHKQKVNRKIAQTKRALEAPDLDKKERKKLQKELLSHRVDLNYILNHPKLDKYIGLYPSSESNDDRTDKLREERRLLVRQAMERGEMDAEPENRRSNGNGQVEELDGGGSAELGASDDDDDDDDSGTDGEEGEPKPSKAPSNRHRVSANTASKSEKPKKPKLQEKPKKSKSAPLAFQQQLVSVKDDDFFDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.74
3 0.74
4 0.73
5 0.71
6 0.67
7 0.71
8 0.73
9 0.75
10 0.77
11 0.78
12 0.77
13 0.8
14 0.84
15 0.84
16 0.84
17 0.8
18 0.78
19 0.72
20 0.72
21 0.66
22 0.57
23 0.49
24 0.44
25 0.44
26 0.44
27 0.48
28 0.47
29 0.51
30 0.6
31 0.62
32 0.67
33 0.67
34 0.63
35 0.59
36 0.53
37 0.48
38 0.44
39 0.42
40 0.36
41 0.3
42 0.28
43 0.22
44 0.19
45 0.17
46 0.16
47 0.15
48 0.14
49 0.21
50 0.22
51 0.25
52 0.26
53 0.26
54 0.25
55 0.3
56 0.34
57 0.27
58 0.28
59 0.25
60 0.24
61 0.25
62 0.24
63 0.23
64 0.23
65 0.28
66 0.36
67 0.39
68 0.46
69 0.53
70 0.6
71 0.63
72 0.68
73 0.71
74 0.74
75 0.79
76 0.78
77 0.76
78 0.76
79 0.78
80 0.78
81 0.79
82 0.74
83 0.74
84 0.76
85 0.79
86 0.78
87 0.75
88 0.68
89 0.6
90 0.57
91 0.49
92 0.4
93 0.37
94 0.32
95 0.33
96 0.33
97 0.32
98 0.33
99 0.35
100 0.44
101 0.46
102 0.5
103 0.51
104 0.57
105 0.65
106 0.68
107 0.72
108 0.71
109 0.74
110 0.67
111 0.6
112 0.52
113 0.42
114 0.35
115 0.29
116 0.22
117 0.13
118 0.12
119 0.13
120 0.12
121 0.12
122 0.13
123 0.12
124 0.11
125 0.12
126 0.11
127 0.11
128 0.16
129 0.17
130 0.18
131 0.17
132 0.17
133 0.18
134 0.19
135 0.18
136 0.13
137 0.14
138 0.16
139 0.17
140 0.18
141 0.18
142 0.19
143 0.2
144 0.27
145 0.32
146 0.33
147 0.36
148 0.42
149 0.46
150 0.49
151 0.48
152 0.46
153 0.42
154 0.39
155 0.39
156 0.32
157 0.26
158 0.21
159 0.2
160 0.16
161 0.13
162 0.13
163 0.13
164 0.15
165 0.16
166 0.18
167 0.19
168 0.19
169 0.2
170 0.2
171 0.21
172 0.28
173 0.3
174 0.28
175 0.28
176 0.28
177 0.27
178 0.25
179 0.21
180 0.12
181 0.07
182 0.06
183 0.05
184 0.04
185 0.03
186 0.03
187 0.02
188 0.03
189 0.03
190 0.03
191 0.04
192 0.04
193 0.04
194 0.05
195 0.06
196 0.05
197 0.06
198 0.06
199 0.06
200 0.06
201 0.05
202 0.05
203 0.05
204 0.05
205 0.09
206 0.09
207 0.13
208 0.16
209 0.16
210 0.18
211 0.21
212 0.28
213 0.32
214 0.43
215 0.48
216 0.56
217 0.59
218 0.61
219 0.61
220 0.57
221 0.58
222 0.58
223 0.57
224 0.5
225 0.5
226 0.5
227 0.53
228 0.6
229 0.61
230 0.59
231 0.6
232 0.67
233 0.76
234 0.82
235 0.87
236 0.88
237 0.9
238 0.92
239 0.94
240 0.95
241 0.94
242 0.93
243 0.86
244 0.84
245 0.83
246 0.82
247 0.77
248 0.74
249 0.74
250 0.65
251 0.65
252 0.55
253 0.49
254 0.44
255 0.39
256 0.34
257 0.25
258 0.25
259 0.23