Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8WV95

Protein Details
Accession L8WV95   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
48-68FSSCARIRSVRQYRRPNISRLHydrophilic
317-347TTPVATTKTKVCRIKRSQKNHFAKREYLRGWHydrophilic
NLS Segment(s)
PositionSequence
347-351WGKRR
Subcellular Location(s) extr 24, nucl 1, mito 1, cyto 1, cyto_nucl 1, cyto_mito 1, mito_nucl 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR005103  AA9  
Gene Ontology GO:0005576  C:extracellular region  
GO:0008810  F:cellulase activity  
GO:0030248  F:cellulose binding  
GO:0030245  P:cellulose catabolic process  
Pfam View protein in Pfam  
PF03443  AA9  
CDD cd21175  LPMO_AA9  
Amino Acid Sequences MCYITLGLCSHLISHLFSTIHTPSHHLGLFRHKNVVHFTCCSCCWRDFSSCARIRSVRQYRRPNISRLATILGPIRPTQSPNRCQESITFDSGDLTCNKGGAVGNGETATVAAGQSVTWTMNTWPADHKGPVTVYMANCGDSCDNFDGSGNKWSKLSSEGLIDAGSFYWASDKLISQGNSWTQTIPSNIMPGNYLMRLEILALHSAGSPQFYPSCTQLKVTGGGDGAPGESELVSIPGVYKSGDPALFGSIWEQPQSWPQVGPNVAAFVNGGSAPAPAPAPAPTTSDPEPSSSKPAPSSTYSEPESYPSPTKGPLPTTPVATTKTKVCRIKRSQKNHFAKREYLRGWGKRRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.16
4 0.16
5 0.21
6 0.2
7 0.23
8 0.22
9 0.25
10 0.23
11 0.28
12 0.3
13 0.26
14 0.28
15 0.35
16 0.44
17 0.42
18 0.47
19 0.43
20 0.45
21 0.52
22 0.54
23 0.48
24 0.42
25 0.43
26 0.4
27 0.41
28 0.41
29 0.37
30 0.33
31 0.33
32 0.35
33 0.37
34 0.37
35 0.42
36 0.48
37 0.51
38 0.51
39 0.52
40 0.51
41 0.5
42 0.56
43 0.61
44 0.6
45 0.64
46 0.72
47 0.75
48 0.82
49 0.82
50 0.77
51 0.75
52 0.69
53 0.62
54 0.53
55 0.48
56 0.37
57 0.34
58 0.32
59 0.25
60 0.22
61 0.2
62 0.21
63 0.18
64 0.22
65 0.3
66 0.36
67 0.42
68 0.48
69 0.55
70 0.52
71 0.52
72 0.52
73 0.5
74 0.45
75 0.4
76 0.33
77 0.26
78 0.27
79 0.27
80 0.25
81 0.18
82 0.16
83 0.13
84 0.12
85 0.12
86 0.12
87 0.12
88 0.11
89 0.13
90 0.11
91 0.12
92 0.12
93 0.12
94 0.1
95 0.09
96 0.08
97 0.05
98 0.04
99 0.03
100 0.03
101 0.03
102 0.04
103 0.05
104 0.05
105 0.05
106 0.06
107 0.06
108 0.12
109 0.12
110 0.13
111 0.15
112 0.18
113 0.2
114 0.2
115 0.2
116 0.17
117 0.17
118 0.18
119 0.17
120 0.17
121 0.15
122 0.17
123 0.17
124 0.16
125 0.15
126 0.15
127 0.13
128 0.1
129 0.13
130 0.11
131 0.11
132 0.1
133 0.11
134 0.11
135 0.12
136 0.2
137 0.18
138 0.17
139 0.17
140 0.17
141 0.17
142 0.19
143 0.19
144 0.12
145 0.12
146 0.12
147 0.12
148 0.12
149 0.11
150 0.08
151 0.06
152 0.05
153 0.04
154 0.04
155 0.04
156 0.04
157 0.05
158 0.06
159 0.06
160 0.07
161 0.12
162 0.12
163 0.12
164 0.14
165 0.15
166 0.17
167 0.17
168 0.16
169 0.12
170 0.13
171 0.13
172 0.13
173 0.11
174 0.12
175 0.11
176 0.11
177 0.11
178 0.11
179 0.11
180 0.09
181 0.09
182 0.07
183 0.07
184 0.07
185 0.06
186 0.06
187 0.06
188 0.06
189 0.06
190 0.06
191 0.06
192 0.07
193 0.07
194 0.06
195 0.06
196 0.07
197 0.07
198 0.08
199 0.1
200 0.13
201 0.17
202 0.17
203 0.18
204 0.19
205 0.19
206 0.21
207 0.2
208 0.18
209 0.14
210 0.13
211 0.13
212 0.1
213 0.09
214 0.06
215 0.05
216 0.04
217 0.04
218 0.04
219 0.04
220 0.04
221 0.04
222 0.04
223 0.05
224 0.05
225 0.05
226 0.06
227 0.06
228 0.07
229 0.1
230 0.1
231 0.1
232 0.11
233 0.12
234 0.12
235 0.12
236 0.12
237 0.12
238 0.13
239 0.13
240 0.13
241 0.12
242 0.16
243 0.2
244 0.19
245 0.17
246 0.17
247 0.22
248 0.22
249 0.23
250 0.19
251 0.17
252 0.16
253 0.15
254 0.14
255 0.08
256 0.08
257 0.07
258 0.07
259 0.05
260 0.05
261 0.06
262 0.06
263 0.06
264 0.06
265 0.07
266 0.08
267 0.11
268 0.11
269 0.16
270 0.17
271 0.22
272 0.24
273 0.27
274 0.27
275 0.28
276 0.31
277 0.29
278 0.35
279 0.32
280 0.33
281 0.32
282 0.34
283 0.34
284 0.34
285 0.38
286 0.35
287 0.38
288 0.38
289 0.37
290 0.35
291 0.34
292 0.33
293 0.31
294 0.31
295 0.27
296 0.27
297 0.27
298 0.32
299 0.33
300 0.36
301 0.36
302 0.39
303 0.39
304 0.41
305 0.42
306 0.41
307 0.4
308 0.38
309 0.36
310 0.37
311 0.43
312 0.48
313 0.54
314 0.58
315 0.65
316 0.73
317 0.81
318 0.84
319 0.86
320 0.88
321 0.9
322 0.93
323 0.93
324 0.92
325 0.87
326 0.86
327 0.83
328 0.82
329 0.73
330 0.72
331 0.71
332 0.71