Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8WE57

Protein Details
Accession L8WE57    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
145-167TEPRSVRTRMSLRRRRARSADQKHydrophilic
NLS Segment(s)
PositionSequence
157-162RRRRAR
Subcellular Location(s) mito 15, nucl 9.5, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MERREIYKIGLLTSYTMERRGSRFELVRAVECAKYGRPFTTRPPTTELGRQTGFFRLDCAACWKHTGGNGELGDVGGEQNGPRLSDDDKNIRDPRVGRHLRGFDYERCLRPTIQTSRSENESDHAPTTGMRPCCSKTTLGCGPPTEPRSVRTRMSLRRRRARSADQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.19
3 0.21
4 0.22
5 0.23
6 0.25
7 0.3
8 0.31
9 0.32
10 0.34
11 0.35
12 0.39
13 0.38
14 0.38
15 0.34
16 0.34
17 0.28
18 0.25
19 0.25
20 0.21
21 0.23
22 0.23
23 0.23
24 0.24
25 0.27
26 0.34
27 0.43
28 0.43
29 0.42
30 0.46
31 0.45
32 0.45
33 0.49
34 0.43
35 0.38
36 0.36
37 0.34
38 0.29
39 0.31
40 0.29
41 0.22
42 0.21
43 0.17
44 0.16
45 0.16
46 0.21
47 0.18
48 0.17
49 0.19
50 0.18
51 0.17
52 0.2
53 0.22
54 0.17
55 0.21
56 0.21
57 0.19
58 0.18
59 0.17
60 0.13
61 0.11
62 0.09
63 0.03
64 0.03
65 0.03
66 0.05
67 0.05
68 0.06
69 0.06
70 0.07
71 0.1
72 0.13
73 0.16
74 0.2
75 0.22
76 0.28
77 0.3
78 0.29
79 0.3
80 0.28
81 0.3
82 0.34
83 0.35
84 0.31
85 0.36
86 0.38
87 0.37
88 0.4
89 0.39
90 0.31
91 0.36
92 0.38
93 0.34
94 0.34
95 0.34
96 0.3
97 0.3
98 0.35
99 0.35
100 0.37
101 0.41
102 0.42
103 0.44
104 0.47
105 0.44
106 0.37
107 0.31
108 0.29
109 0.24
110 0.21
111 0.18
112 0.15
113 0.14
114 0.17
115 0.22
116 0.2
117 0.19
118 0.22
119 0.24
120 0.27
121 0.29
122 0.29
123 0.26
124 0.32
125 0.38
126 0.38
127 0.39
128 0.37
129 0.38
130 0.43
131 0.43
132 0.42
133 0.36
134 0.36
135 0.39
136 0.42
137 0.42
138 0.42
139 0.49
140 0.52
141 0.62
142 0.69
143 0.73
144 0.79
145 0.83
146 0.84
147 0.83