Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8X4M2

Protein Details
Accession L8X4M2    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
47-68GTTRDRQRGPRGREKKWVKMRIBasic
NLS Segment(s)
PositionSequence
52-67RQRGPRGREKKWVKMR
Subcellular Location(s) nucl 9mito 9mito_nucl 9, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MQAGTSSAGHVCAIPDAPPPKLSGHIGQSRERDRDRWVEMNPQDHPGTTRDRQRGPRGREKKWVKMRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.14
3 0.16
4 0.17
5 0.17
6 0.18
7 0.18
8 0.21
9 0.22
10 0.2
11 0.24
12 0.29
13 0.32
14 0.35
15 0.39
16 0.4
17 0.43
18 0.41
19 0.36
20 0.34
21 0.35
22 0.35
23 0.33
24 0.31
25 0.35
26 0.36
27 0.38
28 0.36
29 0.34
30 0.3
31 0.26
32 0.27
33 0.2
34 0.25
35 0.26
36 0.33
37 0.36
38 0.43
39 0.51
40 0.61
41 0.68
42 0.7
43 0.76
44 0.77
45 0.76
46 0.8
47 0.81
48 0.81