Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8X9L3

Protein Details
Accession L8X9L3    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
97-116ATSWRRSDVKYKKNEFKPTIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10cyto_nucl 10, nucl 8, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR036168  AP2_Mu_C_sf  
IPR001392  Clathrin_mu  
IPR011012  Longin-like_dom_sf  
IPR028565  MHD  
IPR043512  Mu2_C  
Gene Ontology GO:0030131  C:clathrin adaptor complex  
GO:0005905  C:clathrin-coated pit  
GO:0006897  P:endocytosis  
GO:0006886  P:intracellular protein transport  
Pfam View protein in Pfam  
PF00928  Adap_comp_sub  
PROSITE View protein in PROSITE  
PS51072  MHD  
CDD cd09251  AP-2_Mu2_Cterm  
Amino Acid Sequences MFERIMSTFYNANAALVFEFCYRFINIGKAYFGKVDEESVKNNFVLIYELLDEILDFGYPQNSEIDTLKMYITTEGVKSELAVREESQKITIQATGATSWRRSDVKYKKNEFKPTIPPGAVLRADVDGQVLMRAYLSGTPECKFGLNDKLVLEQSERGLSDNAVELDDCQFHQCVRLGKFDSDRIISFVPPDGEFELMKYRSTTNINLPLRVHPIVVEHGTSRVEYTVAVKASFNPKLSATNVVLRIPTPLNTTSVDTKVPQGKAKYVPAENVVVWKIPRLQGGSELTFTAMAELTATTTRQAWARPPIDVDFQVLMFTASGLLVRFLKVLEKNNYQSVKWVRYLTKASGTYQIRNKESNT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.11
4 0.13
5 0.11
6 0.12
7 0.12
8 0.14
9 0.14
10 0.16
11 0.17
12 0.21
13 0.22
14 0.23
15 0.26
16 0.25
17 0.26
18 0.26
19 0.25
20 0.22
21 0.2
22 0.22
23 0.24
24 0.25
25 0.27
26 0.28
27 0.29
28 0.26
29 0.26
30 0.21
31 0.16
32 0.17
33 0.13
34 0.12
35 0.11
36 0.11
37 0.11
38 0.11
39 0.1
40 0.08
41 0.07
42 0.05
43 0.04
44 0.05
45 0.07
46 0.07
47 0.08
48 0.09
49 0.1
50 0.12
51 0.13
52 0.14
53 0.13
54 0.14
55 0.13
56 0.12
57 0.12
58 0.11
59 0.11
60 0.11
61 0.11
62 0.11
63 0.11
64 0.11
65 0.1
66 0.14
67 0.17
68 0.16
69 0.17
70 0.18
71 0.24
72 0.26
73 0.26
74 0.23
75 0.22
76 0.21
77 0.21
78 0.21
79 0.15
80 0.14
81 0.14
82 0.13
83 0.14
84 0.15
85 0.15
86 0.15
87 0.19
88 0.19
89 0.2
90 0.3
91 0.37
92 0.44
93 0.54
94 0.61
95 0.68
96 0.74
97 0.82
98 0.77
99 0.73
100 0.73
101 0.69
102 0.66
103 0.56
104 0.5
105 0.41
106 0.4
107 0.34
108 0.25
109 0.19
110 0.14
111 0.14
112 0.13
113 0.12
114 0.07
115 0.06
116 0.06
117 0.05
118 0.04
119 0.04
120 0.04
121 0.04
122 0.05
123 0.07
124 0.09
125 0.1
126 0.11
127 0.12
128 0.12
129 0.13
130 0.12
131 0.13
132 0.19
133 0.18
134 0.19
135 0.19
136 0.21
137 0.2
138 0.2
139 0.18
140 0.12
141 0.12
142 0.11
143 0.11
144 0.1
145 0.1
146 0.09
147 0.09
148 0.09
149 0.09
150 0.07
151 0.07
152 0.07
153 0.07
154 0.08
155 0.07
156 0.07
157 0.07
158 0.06
159 0.09
160 0.11
161 0.15
162 0.17
163 0.21
164 0.23
165 0.24
166 0.27
167 0.26
168 0.25
169 0.22
170 0.2
171 0.17
172 0.16
173 0.14
174 0.12
175 0.12
176 0.11
177 0.1
178 0.11
179 0.09
180 0.1
181 0.09
182 0.1
183 0.13
184 0.13
185 0.13
186 0.13
187 0.13
188 0.15
189 0.18
190 0.19
191 0.19
192 0.29
193 0.29
194 0.3
195 0.31
196 0.3
197 0.32
198 0.3
199 0.25
200 0.15
201 0.16
202 0.16
203 0.15
204 0.14
205 0.1
206 0.11
207 0.11
208 0.11
209 0.1
210 0.08
211 0.07
212 0.07
213 0.09
214 0.11
215 0.12
216 0.12
217 0.12
218 0.14
219 0.2
220 0.23
221 0.22
222 0.2
223 0.2
224 0.22
225 0.24
226 0.25
227 0.22
228 0.24
229 0.24
230 0.24
231 0.23
232 0.21
233 0.22
234 0.18
235 0.17
236 0.15
237 0.15
238 0.16
239 0.17
240 0.2
241 0.2
242 0.21
243 0.21
244 0.19
245 0.23
246 0.27
247 0.29
248 0.31
249 0.3
250 0.33
251 0.37
252 0.41
253 0.42
254 0.37
255 0.37
256 0.35
257 0.35
258 0.3
259 0.28
260 0.24
261 0.2
262 0.18
263 0.18
264 0.19
265 0.19
266 0.21
267 0.2
268 0.2
269 0.24
270 0.29
271 0.28
272 0.26
273 0.24
274 0.21
275 0.19
276 0.18
277 0.13
278 0.08
279 0.06
280 0.06
281 0.05
282 0.07
283 0.08
284 0.08
285 0.08
286 0.09
287 0.11
288 0.12
289 0.14
290 0.19
291 0.27
292 0.29
293 0.3
294 0.32
295 0.34
296 0.36
297 0.35
298 0.33
299 0.24
300 0.22
301 0.21
302 0.18
303 0.15
304 0.1
305 0.09
306 0.06
307 0.05
308 0.06
309 0.06
310 0.08
311 0.08
312 0.09
313 0.09
314 0.09
315 0.15
316 0.2
317 0.28
318 0.34
319 0.41
320 0.44
321 0.52
322 0.55
323 0.49
324 0.53
325 0.53
326 0.52
327 0.49
328 0.51
329 0.46
330 0.5
331 0.55
332 0.51
333 0.52
334 0.48
335 0.46
336 0.49
337 0.5
338 0.51
339 0.53
340 0.57
341 0.53