Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4SCS1

Protein Details
Accession F4SCS1    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
164-188VQRNHLRSKKGKQPKALKRSRHGSHBasic
NLS Segment(s)
PositionSequence
170-184RSKKGKQPKALKRSR
Subcellular Location(s) mito 13.5, cyto_mito 9.833, nucl 7.5, cyto_nucl 6.833, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038717  Tc1-like_DDE_dom  
KEGG mlr:MELLADRAFT_58227  -  
Pfam View protein in Pfam  
PF13358  DDE_3  
Amino Acid Sequences MGFVAYSPQLKVIAIHKLVSGQSPQSINEELLTTISDKSFVRWNALYTHTHVVICNPATYDRRGRPTLYSDEDREFMVELINNDPCLFLDEIQEAMYNHTDLLACRQTIANDLKERLFLTVHKVAKVDPNQSSVLQARFSAAIAHIPSEYLVFLDETGLKLPDVQRNHLRSKKGKQPKALKRSRHGSHYSVLAAICEMGLLAVNAKLNAYCRNEFEAFLKHVLLPVMHPYPN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.23
4 0.25
5 0.26
6 0.26
7 0.25
8 0.19
9 0.21
10 0.22
11 0.23
12 0.24
13 0.24
14 0.22
15 0.2
16 0.19
17 0.15
18 0.14
19 0.14
20 0.11
21 0.11
22 0.1
23 0.12
24 0.11
25 0.12
26 0.19
27 0.19
28 0.24
29 0.23
30 0.25
31 0.27
32 0.3
33 0.3
34 0.27
35 0.31
36 0.27
37 0.26
38 0.24
39 0.22
40 0.23
41 0.22
42 0.18
43 0.15
44 0.18
45 0.2
46 0.24
47 0.3
48 0.31
49 0.36
50 0.38
51 0.39
52 0.38
53 0.41
54 0.43
55 0.42
56 0.41
57 0.37
58 0.37
59 0.36
60 0.32
61 0.28
62 0.22
63 0.15
64 0.12
65 0.1
66 0.09
67 0.11
68 0.11
69 0.11
70 0.1
71 0.1
72 0.09
73 0.11
74 0.1
75 0.08
76 0.09
77 0.1
78 0.1
79 0.1
80 0.11
81 0.08
82 0.09
83 0.09
84 0.08
85 0.07
86 0.07
87 0.07
88 0.06
89 0.11
90 0.11
91 0.11
92 0.11
93 0.12
94 0.11
95 0.16
96 0.19
97 0.18
98 0.18
99 0.19
100 0.19
101 0.2
102 0.2
103 0.15
104 0.13
105 0.1
106 0.14
107 0.2
108 0.2
109 0.2
110 0.2
111 0.2
112 0.26
113 0.29
114 0.28
115 0.22
116 0.24
117 0.25
118 0.25
119 0.27
120 0.23
121 0.2
122 0.16
123 0.15
124 0.13
125 0.12
126 0.11
127 0.1
128 0.07
129 0.09
130 0.08
131 0.09
132 0.08
133 0.08
134 0.08
135 0.07
136 0.07
137 0.05
138 0.05
139 0.04
140 0.04
141 0.05
142 0.06
143 0.06
144 0.07
145 0.07
146 0.07
147 0.09
148 0.12
149 0.17
150 0.19
151 0.24
152 0.32
153 0.37
154 0.46
155 0.49
156 0.54
157 0.56
158 0.62
159 0.67
160 0.7
161 0.72
162 0.73
163 0.78
164 0.82
165 0.85
166 0.85
167 0.83
168 0.81
169 0.84
170 0.79
171 0.77
172 0.71
173 0.64
174 0.58
175 0.53
176 0.45
177 0.36
178 0.31
179 0.23
180 0.17
181 0.14
182 0.1
183 0.06
184 0.05
185 0.03
186 0.04
187 0.03
188 0.04
189 0.06
190 0.06
191 0.07
192 0.07
193 0.08
194 0.11
195 0.18
196 0.23
197 0.24
198 0.26
199 0.33
200 0.34
201 0.35
202 0.35
203 0.35
204 0.32
205 0.32
206 0.3
207 0.23
208 0.24
209 0.24
210 0.21
211 0.16
212 0.2