FuNGI

L8WQ29

Protein Details

Accession

L8WQ29

Localization Confidence

High

Confidence Score

16.1

NoLS Segment(s)

Position	Sequence	Protein Nature
90-110	TKQRHGAYTRWYRNNRTRMRA	Hydrophilic
374-395	REREKARKAKEREKEHEKKEKA	Basic

NLS Segment(s)

Position	Sequence
292-300	PPPPAAKGK
342-425	APAKRVRLTEKERAARDRGREREKIAKQKEREREREKARKAKEREKEHEKKEKAKARELAKKEKEKAKAEMAKAIKKPYPPPPR

Subcellular Location(s)

nucl 13, cyto 11.5, cyto_mito 7

Family & Domain DBs

InterPro	View protein in InterPro IPR009071 HMG_box_dom IPR036910 HMG_box_dom_sf IPR035935 TFB5-like_sf IPR009400 TFIIH_TTDA/Tfb5
Gene Ontology	GO:0000439 C:transcription factor TFIIH core complex GO:0003677 F:DNA binding GO:0006289 P:nucleotide-excision repair GO:0006367 P:transcription initiation at RNA polymerase II promoter
Pfam	View protein in Pfam PF06331 Tfb5
PROSITE	View protein in PROSITE PS50118 HMG_BOX_2

Amino Acid Sequences

MLSLALPLSYYGHLIGFNEPFGPSSNHSSIVTVEPYKQEHTVLVNCTPNVNLKEHALANIEFAQSRPPYALRLSRIVISRVENVWPSWMTKQRHGAYTRWYRNNRTRMRAFKGVLLTCDPAVKQILLILDKMPGQGGFIIKDIDDTHVLVRADDVKRIRIALEQESEYRRIRRSGMRAAQRRHSKVLIFWETSAAGRPSTSTTGRFGLALLMPGPADPEPVWHPRSLISRTVRGNAQTRHSVYTLCLAGTMLSARTLLMRPVLYAHTSTQIRAFSLARIALEPVRKATPPPPPPPAAKGKAGAAAIKYATKSTSTDKTAAPAKKASSATTKTTSASASAAPAPAKRVRLTEKERAARDRGREREKIAKQKEREREREKARKAKEREKEHEKKEKAKARELAKKEKEKAKAEMAKAIKKPYPPPPRAPATAYLLFTSDRTVDRDRGEGVTEDAIKASQAWKDLSDVYTKKAEQARAAWKEDVAKWVSTLNLAQLHAARANREPGTRDDAALNVLPKRPGNGYALFLSDVTSRQDFRDKVDALVKKEHPKDEKDLVQKRISLYGRTSADIWRSMSDKEKVYSNKATEAKAQWDKKFGHLIAEQKEEIAAAHQ

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.13
2	0.16
3	0.15
4	0.15
5	0.16
6	0.15
7	0.15
8	0.17
9	0.2
10	0.19
11	0.26
12	0.27
13	0.29
14	0.29
15	0.29
16	0.29
17	0.29
18	0.3
19	0.24
20	0.25
21	0.26
22	0.29
23	0.31
24	0.3
25	0.27
26	0.25
27	0.28
28	0.3
29	0.3
30	0.33
31	0.34
32	0.33
33	0.33
34	0.32
35	0.34
36	0.32
37	0.31
38	0.27
39	0.25
40	0.3
41	0.3
42	0.3
43	0.27
44	0.24
45	0.24
46	0.25
47	0.23
48	0.19
49	0.18
50	0.23
51	0.19
52	0.2
53	0.19
54	0.18
55	0.2
56	0.26
57	0.32
58	0.3
59	0.34
60	0.35
61	0.37
62	0.39
63	0.38
64	0.36
65	0.33
66	0.32
67	0.29
68	0.3
69	0.27
70	0.24
71	0.26
72	0.24
73	0.23
74	0.26
75	0.33
76	0.35
77	0.4
78	0.49
79	0.5
80	0.57
81	0.57
82	0.54
83	0.55
84	0.62
85	0.65
86	0.65
87	0.67
88	0.69
89	0.75
90	0.82
91	0.8
92	0.79
93	0.78
94	0.77
95	0.79
96	0.78
97	0.7
98	0.65
99	0.63
100	0.56
101	0.49
102	0.43
103	0.37
104	0.29
105	0.29
106	0.23
107	0.18
108	0.18
109	0.15
110	0.12
111	0.12
112	0.15
113	0.14
114	0.15
115	0.13
116	0.13
117	0.14
118	0.14
119	0.13
120	0.09
121	0.09
122	0.1
123	0.11
124	0.1
125	0.11
126	0.11
127	0.1
128	0.12
129	0.12
130	0.12
131	0.12
132	0.12
133	0.11
134	0.15
135	0.15
136	0.14
137	0.15
138	0.19
139	0.19
140	0.24
141	0.25
142	0.23
143	0.24
144	0.25
145	0.24
146	0.21
147	0.23
148	0.23
149	0.25
150	0.24
151	0.28
152	0.3
153	0.33
154	0.33
155	0.33
156	0.3
157	0.29
158	0.32
159	0.36
160	0.4
161	0.46
162	0.51
163	0.58
164	0.64
165	0.66
166	0.71
167	0.73
168	0.7
169	0.64
170	0.59
171	0.5
172	0.45
173	0.49
174	0.46
175	0.38
176	0.34
177	0.31
178	0.28
179	0.27
180	0.26
181	0.17
182	0.12
183	0.1
184	0.11
185	0.12
186	0.15
187	0.17
188	0.16
189	0.18
190	0.19
191	0.19
192	0.19
193	0.16
194	0.14
195	0.13
196	0.11
197	0.09
198	0.08
199	0.07
200	0.07
201	0.08
202	0.06
203	0.07
204	0.06
205	0.09
206	0.12
207	0.17
208	0.19
209	0.18
210	0.19
211	0.21
212	0.26
213	0.27
214	0.31
215	0.29
216	0.34
217	0.35
218	0.38
219	0.36
220	0.34
221	0.38
222	0.34
223	0.34
224	0.34
225	0.34
226	0.34
227	0.33
228	0.29
229	0.23
230	0.24
231	0.2
232	0.14
233	0.13
234	0.1
235	0.09
236	0.09
237	0.09
238	0.05
239	0.05
240	0.05
241	0.05
242	0.06
243	0.06
244	0.07
245	0.08
246	0.08
247	0.08
248	0.09
249	0.11
250	0.1
251	0.11
252	0.11
253	0.15
254	0.15
255	0.16
256	0.17
257	0.16
258	0.15
259	0.16
260	0.16
261	0.1
262	0.12
263	0.12
264	0.1
265	0.1
266	0.1
267	0.11
268	0.13
269	0.12
270	0.13
271	0.14
272	0.13
273	0.15
274	0.19
275	0.26
276	0.31
277	0.35
278	0.38
279	0.39
280	0.41
281	0.44
282	0.46
283	0.4
284	0.35
285	0.32
286	0.28
287	0.28
288	0.27
289	0.23
290	0.16
291	0.13
292	0.12
293	0.11
294	0.11
295	0.08
296	0.08
297	0.08
298	0.1
299	0.12
300	0.17
301	0.18
302	0.21
303	0.2
304	0.23
305	0.29
306	0.29
307	0.28
308	0.26
309	0.24
310	0.27
311	0.28
312	0.27
313	0.27
314	0.28
315	0.3
316	0.31
317	0.31
318	0.25
319	0.26
320	0.24
321	0.18
322	0.15
323	0.12
324	0.1
325	0.1
326	0.1
327	0.1
328	0.1
329	0.13
330	0.15
331	0.17
332	0.17
333	0.2
334	0.24
335	0.32
336	0.38
337	0.43
338	0.48
339	0.53
340	0.55
341	0.55
342	0.55
343	0.51
344	0.52
345	0.53
346	0.53
347	0.53
348	0.53
349	0.53
350	0.58
351	0.61
352	0.64
353	0.64
354	0.64
355	0.63
356	0.69
357	0.75
358	0.74
359	0.77
360	0.73
361	0.73
362	0.75
363	0.79
364	0.79
365	0.78
366	0.77
367	0.77
368	0.78
369	0.79
370	0.77
371	0.77
372	0.77
373	0.79
374	0.8
375	0.79
376	0.82
377	0.78
378	0.77
379	0.77
380	0.77
381	0.71
382	0.7
383	0.67
384	0.66
385	0.7
386	0.68
387	0.69
388	0.69
389	0.73
390	0.72
391	0.72
392	0.72
393	0.67
394	0.65
395	0.64
396	0.62
397	0.55
398	0.55
399	0.53
400	0.52
401	0.5
402	0.51
403	0.44
404	0.41
405	0.45
406	0.48
407	0.54
408	0.52
409	0.57
410	0.59
411	0.61
412	0.6
413	0.58
414	0.51
415	0.47
416	0.45
417	0.39
418	0.32
419	0.27
420	0.25
421	0.22
422	0.19
423	0.14
424	0.12
425	0.15
426	0.18
427	0.21
428	0.22
429	0.24
430	0.24
431	0.23
432	0.23
433	0.19
434	0.17
435	0.17
436	0.16
437	0.14
438	0.13
439	0.11
440	0.1
441	0.1
442	0.1
443	0.09
444	0.11
445	0.12
446	0.12
447	0.15
448	0.16
449	0.17
450	0.23
451	0.22
452	0.23
453	0.27
454	0.26
455	0.31
456	0.34
457	0.36
458	0.32
459	0.38
460	0.45
461	0.45
462	0.49
463	0.44
464	0.4
465	0.42
466	0.4
467	0.38
468	0.3
469	0.25
470	0.22
471	0.22
472	0.21
473	0.18
474	0.17
475	0.15
476	0.16
477	0.15
478	0.16
479	0.17
480	0.18
481	0.2
482	0.21
483	0.19
484	0.19
485	0.25
486	0.26
487	0.27
488	0.28
489	0.28
490	0.35
491	0.33
492	0.32
493	0.27
494	0.25
495	0.25
496	0.25
497	0.23
498	0.19
499	0.21
500	0.22
501	0.22
502	0.24
503	0.23
504	0.24
505	0.26
506	0.26
507	0.27
508	0.25
509	0.26
510	0.24
511	0.22
512	0.2
513	0.17
514	0.15
515	0.16
516	0.17
517	0.17
518	0.19
519	0.27
520	0.26
521	0.3
522	0.38
523	0.35
524	0.36
525	0.44
526	0.47
527	0.43
528	0.51
529	0.52
530	0.52
531	0.57
532	0.62
533	0.6
534	0.6
535	0.63
536	0.63
537	0.65
538	0.66
539	0.68
540	0.67
541	0.65
542	0.63
543	0.57
544	0.58
545	0.52
546	0.46
547	0.41
548	0.42
549	0.4
550	0.38
551	0.38
552	0.33
553	0.35
554	0.34
555	0.32
556	0.27
557	0.27
558	0.27
559	0.33
560	0.34
561	0.35
562	0.33
563	0.4
564	0.42
565	0.47
566	0.53
567	0.48
568	0.52
569	0.52
570	0.53
571	0.52
572	0.51
573	0.54
574	0.55
575	0.6
576	0.55
577	0.58
578	0.58
579	0.56
580	0.61
581	0.51
582	0.49
583	0.46
584	0.5
585	0.49
586	0.52
587	0.47
588	0.38
589	0.37
590	0.3

L8WQ29

3D AlphaFold-predicted Structure Viewer