Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8WUK8

Protein Details
Accession L8WUK8    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
60-86VLAVPKKKTSPSKKRMRSANKGLKDKTHydrophilic
133-156SVDKYQFRLRKKRVEKRGNRYNENHydrophilic
204-223RLANRNKKVKHPPSRGSDNLHydrophilic
NLS Segment(s)
PositionSequence
64-88PKKKTSPSKKRMRSANKGLKDKTSA
142-148RKKRVEK
Subcellular Location(s) mito 18, mito_nucl 13.333, cyto_mito 9.833, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MASLALPLARTSARIAWSSRLFGLGITTGPAPSGPTLRLAERLSALPSLRTLFELFPPIVLAVPKKKTSPSKKRMRSANKGLKDKTSAAGPPSERTMFARSVSRRSTVRGKQVRGKLGREFRCSYGCRSMAQSVDKYQFRLRKKRVEKRGNRYNENSMCCYMRIKKRKTSFKSSGALQIRFRRGTQAEFKSPRSSLILEIFLVRLANRNKKVKHPPSRGSDNLSGGANGGRNSPRLGHDRCLVAHTANRIEAHLGTLTTTEWPPSTTLPIRGVGNIALATRQHKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.29
4 0.32
5 0.34
6 0.31
7 0.29
8 0.25
9 0.22
10 0.22
11 0.16
12 0.13
13 0.11
14 0.11
15 0.1
16 0.1
17 0.1
18 0.09
19 0.1
20 0.12
21 0.11
22 0.15
23 0.18
24 0.19
25 0.24
26 0.24
27 0.24
28 0.24
29 0.24
30 0.22
31 0.22
32 0.22
33 0.17
34 0.18
35 0.17
36 0.16
37 0.16
38 0.16
39 0.14
40 0.16
41 0.19
42 0.17
43 0.16
44 0.16
45 0.14
46 0.13
47 0.13
48 0.15
49 0.18
50 0.23
51 0.25
52 0.27
53 0.33
54 0.43
55 0.53
56 0.6
57 0.64
58 0.7
59 0.77
60 0.84
61 0.87
62 0.87
63 0.86
64 0.86
65 0.86
66 0.84
67 0.82
68 0.77
69 0.7
70 0.64
71 0.55
72 0.45
73 0.38
74 0.31
75 0.25
76 0.28
77 0.25
78 0.23
79 0.25
80 0.24
81 0.21
82 0.22
83 0.24
84 0.2
85 0.21
86 0.26
87 0.25
88 0.3
89 0.32
90 0.32
91 0.3
92 0.33
93 0.4
94 0.39
95 0.47
96 0.49
97 0.51
98 0.55
99 0.61
100 0.65
101 0.6
102 0.58
103 0.55
104 0.57
105 0.57
106 0.55
107 0.52
108 0.46
109 0.47
110 0.45
111 0.42
112 0.39
113 0.35
114 0.3
115 0.3
116 0.3
117 0.26
118 0.27
119 0.25
120 0.21
121 0.26
122 0.26
123 0.25
124 0.28
125 0.32
126 0.36
127 0.45
128 0.47
129 0.52
130 0.62
131 0.7
132 0.76
133 0.8
134 0.83
135 0.83
136 0.87
137 0.84
138 0.79
139 0.73
140 0.71
141 0.65
142 0.59
143 0.51
144 0.43
145 0.36
146 0.31
147 0.3
148 0.29
149 0.33
150 0.39
151 0.42
152 0.49
153 0.58
154 0.68
155 0.72
156 0.75
157 0.73
158 0.7
159 0.68
160 0.61
161 0.61
162 0.56
163 0.53
164 0.48
165 0.47
166 0.45
167 0.43
168 0.41
169 0.38
170 0.34
171 0.36
172 0.4
173 0.39
174 0.43
175 0.46
176 0.48
177 0.47
178 0.45
179 0.42
180 0.36
181 0.3
182 0.24
183 0.23
184 0.21
185 0.17
186 0.18
187 0.16
188 0.14
189 0.13
190 0.1
191 0.14
192 0.19
193 0.27
194 0.34
195 0.42
196 0.44
197 0.54
198 0.65
199 0.69
200 0.74
201 0.75
202 0.76
203 0.76
204 0.82
205 0.76
206 0.72
207 0.65
208 0.57
209 0.49
210 0.41
211 0.33
212 0.25
213 0.23
214 0.18
215 0.13
216 0.15
217 0.14
218 0.15
219 0.16
220 0.18
221 0.21
222 0.27
223 0.31
224 0.32
225 0.35
226 0.37
227 0.36
228 0.37
229 0.34
230 0.28
231 0.27
232 0.27
233 0.26
234 0.26
235 0.25
236 0.23
237 0.24
238 0.21
239 0.2
240 0.17
241 0.14
242 0.12
243 0.12
244 0.12
245 0.13
246 0.13
247 0.12
248 0.11
249 0.13
250 0.14
251 0.16
252 0.22
253 0.23
254 0.28
255 0.29
256 0.32
257 0.32
258 0.31
259 0.3
260 0.23
261 0.22
262 0.18
263 0.15
264 0.14
265 0.15