Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8WX71

Protein Details
Accession L8WX71   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
191-216SLVTPRSSRRIKKATQKDGRKVGSKDHydrophilic
NLS Segment(s)
PositionSequence
200-203RIKK
Subcellular Location(s) cysk 24, nucl 1, mito 1, cyto 1, cyto_nucl 1, cyto_mito 1, mito_nucl 1
Family & Domain DBs
Amino Acid Sequences MLHRMLGQWVIWLDIEEQENLITALINSQMTMWIIAIRHIAESALALDLEHTLTEMKGAISGLVIAGSTDLRIGAANFQAVVYEWRSSAGSFMMILQPFLYRSFDSYLLIPDSCRHLEMFKSPVAWLYISFLAYTRLKTVWDFVGFIGSISRDLLRWVHKYTISEDGGDGRDVGIGAEGDVVIGESQCNDSLVTPRSSRRIKKATQKDGRKVGSKDGLCAESVLEGGTCGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.13
4 0.13
5 0.12
6 0.12
7 0.11
8 0.1
9 0.07
10 0.05
11 0.06
12 0.08
13 0.08
14 0.07
15 0.07
16 0.08
17 0.09
18 0.09
19 0.08
20 0.08
21 0.09
22 0.1
23 0.11
24 0.11
25 0.11
26 0.1
27 0.1
28 0.08
29 0.08
30 0.08
31 0.07
32 0.06
33 0.05
34 0.06
35 0.06
36 0.06
37 0.05
38 0.05
39 0.05
40 0.05
41 0.06
42 0.06
43 0.05
44 0.06
45 0.06
46 0.06
47 0.05
48 0.05
49 0.05
50 0.04
51 0.04
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.04
59 0.04
60 0.04
61 0.06
62 0.06
63 0.06
64 0.06
65 0.06
66 0.06
67 0.06
68 0.08
69 0.08
70 0.08
71 0.08
72 0.09
73 0.09
74 0.09
75 0.09
76 0.08
77 0.06
78 0.06
79 0.07
80 0.09
81 0.09
82 0.09
83 0.08
84 0.08
85 0.09
86 0.1
87 0.11
88 0.07
89 0.09
90 0.12
91 0.12
92 0.12
93 0.12
94 0.12
95 0.12
96 0.12
97 0.1
98 0.09
99 0.12
100 0.11
101 0.11
102 0.1
103 0.1
104 0.11
105 0.13
106 0.15
107 0.12
108 0.13
109 0.12
110 0.13
111 0.13
112 0.12
113 0.1
114 0.1
115 0.1
116 0.09
117 0.09
118 0.08
119 0.11
120 0.12
121 0.12
122 0.11
123 0.11
124 0.11
125 0.12
126 0.14
127 0.13
128 0.13
129 0.13
130 0.12
131 0.13
132 0.12
133 0.12
134 0.1
135 0.07
136 0.07
137 0.07
138 0.07
139 0.05
140 0.07
141 0.1
142 0.14
143 0.17
144 0.2
145 0.22
146 0.24
147 0.26
148 0.27
149 0.32
150 0.28
151 0.25
152 0.23
153 0.22
154 0.21
155 0.2
156 0.17
157 0.09
158 0.09
159 0.08
160 0.08
161 0.06
162 0.05
163 0.05
164 0.05
165 0.04
166 0.04
167 0.04
168 0.04
169 0.03
170 0.04
171 0.03
172 0.04
173 0.05
174 0.06
175 0.07
176 0.07
177 0.08
178 0.13
179 0.17
180 0.2
181 0.22
182 0.26
183 0.34
184 0.43
185 0.49
186 0.54
187 0.59
188 0.64
189 0.72
190 0.79
191 0.81
192 0.83
193 0.87
194 0.86
195 0.87
196 0.85
197 0.82
198 0.74
199 0.71
200 0.7
201 0.6
202 0.55
203 0.5
204 0.44
205 0.36
206 0.34
207 0.26
208 0.17
209 0.16
210 0.13
211 0.08