Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8WND7

Protein Details
Accession L8WND7    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
80-109NSDKKKKTGVDPKGRRRASRGRKTKYPADCBasic
NLS Segment(s)
PositionSequence
71-104QARPRPQGGNSDKKKKTGVDPKGRRRASRGRKTK
Subcellular Location(s) nucl 16, mito 8, cyto 2
Family & Domain DBs
Amino Acid Sequences MDHHEYFVRVVAREPAVPGSLIPGSPLYKWRSQGLLISADKYRQLTGALCLAEDGRLAYHLLPVPKNGPGQARPRPQGGNSDKKKKTGVDPKGRRRASRGRKTKYPADCLDQMQNIRAKRSVPGSLIPGSPLYKWRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.19
4 0.19
5 0.17
6 0.15
7 0.14
8 0.13
9 0.12
10 0.13
11 0.13
12 0.14
13 0.2
14 0.21
15 0.24
16 0.27
17 0.28
18 0.28
19 0.28
20 0.3
21 0.28
22 0.3
23 0.27
24 0.27
25 0.25
26 0.23
27 0.24
28 0.21
29 0.19
30 0.12
31 0.13
32 0.11
33 0.12
34 0.15
35 0.13
36 0.12
37 0.12
38 0.11
39 0.1
40 0.09
41 0.07
42 0.04
43 0.05
44 0.05
45 0.05
46 0.07
47 0.09
48 0.11
49 0.11
50 0.12
51 0.13
52 0.14
53 0.15
54 0.15
55 0.15
56 0.18
57 0.25
58 0.32
59 0.37
60 0.37
61 0.39
62 0.39
63 0.37
64 0.43
65 0.42
66 0.45
67 0.46
68 0.55
69 0.53
70 0.55
71 0.57
72 0.49
73 0.52
74 0.52
75 0.55
76 0.56
77 0.65
78 0.72
79 0.8
80 0.81
81 0.73
82 0.7
83 0.71
84 0.71
85 0.71
86 0.72
87 0.69
88 0.75
89 0.79
90 0.81
91 0.77
92 0.74
93 0.67
94 0.63
95 0.59
96 0.53
97 0.52
98 0.48
99 0.41
100 0.38
101 0.39
102 0.34
103 0.34
104 0.32
105 0.28
106 0.28
107 0.32
108 0.32
109 0.3
110 0.32
111 0.33
112 0.34
113 0.33
114 0.3
115 0.28
116 0.24
117 0.22