Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8WL84

Protein Details
Accession L8WL84    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
260-280SSLPETKTWMRRRSARPGWRLHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR036852  Peptidase_S8/S53_dom_sf  
IPR015500  Peptidase_S8_subtilisin-rel  
IPR010259  S8pro/Inhibitor_I9  
IPR037045  S8pro/Inhibitor_I9_sf  
Gene Ontology GO:0004252  F:serine-type endopeptidase activity  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF05922  Inhibitor_I9  
PROSITE View protein in PROSITE  
PS51892  SUBTILASE  
Amino Acid Sequences MRSTFILACLASSVCTVFAGPVADRVPITKRAGPVNPNSYIVKLKDGVSKSAHLKTLLSGSKVAYNYGPAFQGYAAQLDDQALDYVRKSKDVESIFQDVQVQCVPGPFSSRSTLEGQVAARGMGYESSPLVKRVNGTGVDIYQIDTGIYTAHTQFGGRAKWGYPNADGNGHGTALASIIVGSTYGIATRANITAIKGESIKINHGASITHMIDLAPQAFGDDGSANLSDIISGINWVITNSGPAATRKLPTPSTPGSTWSSLPETKTWMRRRSARPGWRLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.08
4 0.07
5 0.08
6 0.1
7 0.1
8 0.13
9 0.13
10 0.14
11 0.14
12 0.16
13 0.19
14 0.23
15 0.28
16 0.29
17 0.31
18 0.37
19 0.43
20 0.46
21 0.51
22 0.51
23 0.48
24 0.47
25 0.45
26 0.41
27 0.4
28 0.36
29 0.31
30 0.27
31 0.27
32 0.31
33 0.31
34 0.33
35 0.31
36 0.34
37 0.35
38 0.38
39 0.38
40 0.31
41 0.3
42 0.27
43 0.32
44 0.3
45 0.27
46 0.24
47 0.22
48 0.26
49 0.26
50 0.25
51 0.18
52 0.19
53 0.18
54 0.18
55 0.18
56 0.13
57 0.13
58 0.12
59 0.14
60 0.11
61 0.11
62 0.1
63 0.09
64 0.09
65 0.09
66 0.09
67 0.07
68 0.07
69 0.07
70 0.07
71 0.07
72 0.13
73 0.13
74 0.15
75 0.16
76 0.17
77 0.24
78 0.26
79 0.28
80 0.27
81 0.32
82 0.3
83 0.29
84 0.31
85 0.24
86 0.23
87 0.2
88 0.16
89 0.11
90 0.12
91 0.12
92 0.08
93 0.12
94 0.12
95 0.13
96 0.16
97 0.17
98 0.19
99 0.21
100 0.22
101 0.19
102 0.2
103 0.18
104 0.16
105 0.15
106 0.12
107 0.09
108 0.07
109 0.07
110 0.05
111 0.05
112 0.04
113 0.04
114 0.06
115 0.07
116 0.08
117 0.09
118 0.09
119 0.1
120 0.11
121 0.14
122 0.12
123 0.13
124 0.12
125 0.12
126 0.12
127 0.11
128 0.11
129 0.07
130 0.07
131 0.05
132 0.05
133 0.05
134 0.04
135 0.04
136 0.04
137 0.05
138 0.05
139 0.06
140 0.06
141 0.08
142 0.11
143 0.11
144 0.11
145 0.12
146 0.12
147 0.17
148 0.19
149 0.2
150 0.18
151 0.21
152 0.21
153 0.22
154 0.21
155 0.18
156 0.16
157 0.14
158 0.12
159 0.09
160 0.07
161 0.06
162 0.06
163 0.04
164 0.03
165 0.03
166 0.03
167 0.03
168 0.03
169 0.03
170 0.03
171 0.03
172 0.04
173 0.04
174 0.05
175 0.06
176 0.07
177 0.07
178 0.08
179 0.08
180 0.11
181 0.11
182 0.12
183 0.11
184 0.11
185 0.14
186 0.14
187 0.16
188 0.17
189 0.17
190 0.16
191 0.16
192 0.15
193 0.14
194 0.19
195 0.17
196 0.14
197 0.14
198 0.13
199 0.14
200 0.15
201 0.13
202 0.07
203 0.06
204 0.06
205 0.06
206 0.06
207 0.07
208 0.06
209 0.05
210 0.07
211 0.07
212 0.07
213 0.07
214 0.07
215 0.06
216 0.06
217 0.06
218 0.04
219 0.05
220 0.04
221 0.05
222 0.05
223 0.05
224 0.06
225 0.06
226 0.07
227 0.07
228 0.09
229 0.1
230 0.12
231 0.17
232 0.19
233 0.2
234 0.23
235 0.28
236 0.3
237 0.31
238 0.37
239 0.37
240 0.4
241 0.39
242 0.4
243 0.39
244 0.38
245 0.36
246 0.33
247 0.34
248 0.31
249 0.32
250 0.3
251 0.32
252 0.38
253 0.46
254 0.51
255 0.53
256 0.59
257 0.67
258 0.73
259 0.77
260 0.8
261 0.8