Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8X0H2

Protein Details
Accession L8X0H2    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
48-73DPDYEPVRRKKLKRFVKQLVNPERSGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MAIVNQSPEHSDDADSHYELNSRTAPLSRITTAPSKIGNAIGNAFSRDPDYEPVRRKKLKRFVKQLVNPERSGTEKEITLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.19
4 0.17
5 0.18
6 0.17
7 0.18
8 0.15
9 0.13
10 0.14
11 0.15
12 0.16
13 0.16
14 0.19
15 0.18
16 0.17
17 0.19
18 0.22
19 0.22
20 0.22
21 0.2
22 0.17
23 0.17
24 0.18
25 0.16
26 0.12
27 0.12
28 0.11
29 0.11
30 0.11
31 0.11
32 0.09
33 0.09
34 0.1
35 0.1
36 0.13
37 0.17
38 0.23
39 0.31
40 0.39
41 0.47
42 0.54
43 0.59
44 0.65
45 0.72
46 0.76
47 0.78
48 0.81
49 0.81
50 0.84
51 0.86
52 0.86
53 0.86
54 0.8
55 0.71
56 0.62
57 0.55
58 0.47
59 0.45
60 0.38
61 0.31