Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8X1J7

Protein Details
Accession L8X1J7    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
89-122YQPSQRIRKRRHGFLARMRKRTGRNVLARRKAKGBasic
NLS Segment(s)
PositionSequence
94-125RIRKRRHGFLARMRKRTGRNVLARRKAKGRRS
Subcellular Location(s) mito 18, extr 4, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRILVRILPRFVAPLIRPATQAVPKLSLSRIPQTASTVPSFSPILSQLGPSLLSAAFRRPTLSTPLGIGSGWVLGALLQARHSHGDEYQPSQRIRKRRHGFLARMRKRTGRNVLARRKAKGRRSLTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.28
4 0.28
5 0.28
6 0.28
7 0.33
8 0.31
9 0.34
10 0.28
11 0.28
12 0.28
13 0.29
14 0.28
15 0.28
16 0.27
17 0.29
18 0.29
19 0.27
20 0.27
21 0.29
22 0.3
23 0.28
24 0.25
25 0.21
26 0.19
27 0.2
28 0.19
29 0.14
30 0.13
31 0.11
32 0.12
33 0.11
34 0.11
35 0.09
36 0.09
37 0.1
38 0.08
39 0.08
40 0.06
41 0.07
42 0.07
43 0.1
44 0.1
45 0.1
46 0.12
47 0.11
48 0.13
49 0.18
50 0.18
51 0.16
52 0.15
53 0.16
54 0.15
55 0.14
56 0.12
57 0.07
58 0.05
59 0.05
60 0.04
61 0.03
62 0.02
63 0.03
64 0.04
65 0.04
66 0.05
67 0.06
68 0.07
69 0.09
70 0.1
71 0.1
72 0.11
73 0.16
74 0.17
75 0.22
76 0.26
77 0.3
78 0.31
79 0.38
80 0.42
81 0.46
82 0.52
83 0.58
84 0.61
85 0.65
86 0.74
87 0.76
88 0.8
89 0.81
90 0.85
91 0.83
92 0.81
93 0.76
94 0.73
95 0.69
96 0.7
97 0.69
98 0.68
99 0.69
100 0.73
101 0.8
102 0.83
103 0.83
104 0.79
105 0.79
106 0.79
107 0.78
108 0.77