Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8WCJ2

Protein Details
Accession L8WCJ2    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MRVRLVRRTCRMPRRGARFIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, cyto 8.5, cyto_nucl 6, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
Amino Acid Sequences MRVRLVRRTCRMPRRGARFIWFGKRPWGGTDKKLPQIARMRDLLSRGIGVHHGGLLPLVKEVVEILFARGLVKVLFATETFAMGVNMPARSVVFSGIRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.74
4 0.7
5 0.67
6 0.65
7 0.64
8 0.58
9 0.5
10 0.51
11 0.5
12 0.45
13 0.41
14 0.42
15 0.36
16 0.38
17 0.46
18 0.45
19 0.47
20 0.51
21 0.47
22 0.47
23 0.52
24 0.5
25 0.44
26 0.4
27 0.36
28 0.33
29 0.34
30 0.28
31 0.19
32 0.16
33 0.12
34 0.11
35 0.1
36 0.09
37 0.07
38 0.06
39 0.05
40 0.05
41 0.05
42 0.05
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.05
51 0.05
52 0.06
53 0.06
54 0.07
55 0.07
56 0.07
57 0.08
58 0.06
59 0.06
60 0.06
61 0.06
62 0.07
63 0.06
64 0.09
65 0.08
66 0.09
67 0.09
68 0.09
69 0.09
70 0.08
71 0.1
72 0.1
73 0.1
74 0.1
75 0.1
76 0.1
77 0.11
78 0.11
79 0.13