FuNGI

L8X975

Protein Details

Accession

L8X975

Localization Confidence

Medium

Confidence Score

10.6

NoLS Segment(s)

Position	Sequence	Protein Nature
116-138	DSGRSRSCACRRSPRRRTSVVHT	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 14, mito 8, cyto 3

Family & Domain DBs

InterPro	View protein in InterPro IPR028877 50S_L18Ae/Ribosomal_L18a/L20 IPR023573 Ribosomal_L18a//L18Ae/LX IPR029071 Ubiquitin-like_domsf IPR039540 UBL3-like_ubiquitin_dom
Gene Ontology	GO:1990904 C:ribonucleoprotein complex GO:0005840 C:ribosome GO:0003735 F:structural constituent of ribosome GO:0006412 P:translation
Pfam	View protein in Pfam PF13881 Rad60-SLD_2 PF01775 Ribosomal_L18A

Amino Acid Sequences

MGRYIEYQVIGRKLPTAAEETPKLYRMRIFAPNEVVAKSRFWYYLRQLKKVKKATGEIVSVNKVKKISEKSPLRIKNFGVWLRYDSRSGTKSSVNCRVPTQYTHCTKTWQPATVPDSGRSRSCACRRSPRRRTSVVHTSSSSQNPSSGSPCLIGCSKPGASLLPTGPRLSKLVYSSVFLLAWLDGWLAGWLVQGEEDGRSRVYLLLREHVMLSYACMLCDYAKAQKWLFLICCEWGKERKGMPADIKIKQCFELSAAAVKLDLMLRTFVSDDDNDLPLLRSDPPVVTATMTTLAPTPVPASGPASDLGLDSQAPTLAPPTANSSPRHEHATLPPSEPAAPAPDPTDISVTFLLISGDRQQMHFAPTMTFGRVKEAFWGAWTPENPDTKPPSPSFLRVLHMGKVLSDDQTLASRSYVVDVYDATLTLFQTPNSPTSRHLPQAPSCQAAPHFSQ

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.25
2	0.24
3	0.24
4	0.25
5	0.3
6	0.33
7	0.34
8	0.36
9	0.39
10	0.38
11	0.34
12	0.34
13	0.31
14	0.34
15	0.4
16	0.41
17	0.42
18	0.46
19	0.48
20	0.46
21	0.43
22	0.4
23	0.32
24	0.29
25	0.25
26	0.23
27	0.22
28	0.21
29	0.28
30	0.35
31	0.43
32	0.48
33	0.55
34	0.61
35	0.67
36	0.76
37	0.77
38	0.75
39	0.73
40	0.72
41	0.71
42	0.68
43	0.63
44	0.56
45	0.51
46	0.5
47	0.47
48	0.42
49	0.38
50	0.32
51	0.3
52	0.34
53	0.38
54	0.39
55	0.45
56	0.52
57	0.57
58	0.67
59	0.74
60	0.71
61	0.68
62	0.63
63	0.6
64	0.6
65	0.56
66	0.49
67	0.42
68	0.41
69	0.42
70	0.41
71	0.35
72	0.3
73	0.31
74	0.31
75	0.32
76	0.3
77	0.31
78	0.34
79	0.41
80	0.48
81	0.46
82	0.46
83	0.46
84	0.48
85	0.46
86	0.46
87	0.46
88	0.45
89	0.47
90	0.51
91	0.48
92	0.47
93	0.47
94	0.51
95	0.49
96	0.43
97	0.38
98	0.41
99	0.44
100	0.46
101	0.46
102	0.4
103	0.4
104	0.38
105	0.38
106	0.34
107	0.34
108	0.36
109	0.42
110	0.44
111	0.47
112	0.56
113	0.65
114	0.73
115	0.8
116	0.8
117	0.81
118	0.82
119	0.8
120	0.78
121	0.78
122	0.72
123	0.65
124	0.57
125	0.51
126	0.48
127	0.46
128	0.4
129	0.29
130	0.26
131	0.23
132	0.23
133	0.23
134	0.19
135	0.16
136	0.15
137	0.15
138	0.15
139	0.15
140	0.14
141	0.12
142	0.15
143	0.15
144	0.14
145	0.15
146	0.13
147	0.13
148	0.16
149	0.16
150	0.17
151	0.18
152	0.18
153	0.18
154	0.19
155	0.19
156	0.17
157	0.18
158	0.15
159	0.18
160	0.18
161	0.18
162	0.18
163	0.18
164	0.16
165	0.13
166	0.12
167	0.08
168	0.07
169	0.06
170	0.05
171	0.04
172	0.04
173	0.04
174	0.03
175	0.04
176	0.03
177	0.03
178	0.03
179	0.03
180	0.03
181	0.04
182	0.05
183	0.05
184	0.06
185	0.06
186	0.06
187	0.07
188	0.09
189	0.09
190	0.13
191	0.13
192	0.15
193	0.16
194	0.16
195	0.16
196	0.14
197	0.14
198	0.1
199	0.09
200	0.1
201	0.1
202	0.09
203	0.09
204	0.09
205	0.08
206	0.09
207	0.1
208	0.1
209	0.13
210	0.15
211	0.15
212	0.18
213	0.19
214	0.2
215	0.19
216	0.15
217	0.14
218	0.13
219	0.15
220	0.13
221	0.15
222	0.17
223	0.18
224	0.21
225	0.22
226	0.25
227	0.26
228	0.28
229	0.28
230	0.33
231	0.37
232	0.38
233	0.41
234	0.38
235	0.36
236	0.35
237	0.32
238	0.24
239	0.19
240	0.16
241	0.12
242	0.13
243	0.12
244	0.11
245	0.11
246	0.1
247	0.09
248	0.08
249	0.07
250	0.05
251	0.06
252	0.06
253	0.07
254	0.07
255	0.07
256	0.08
257	0.08
258	0.1
259	0.11
260	0.12
261	0.11
262	0.11
263	0.11
264	0.1
265	0.11
266	0.1
267	0.09
268	0.09
269	0.09
270	0.11
271	0.12
272	0.12
273	0.11
274	0.1
275	0.1
276	0.1
277	0.1
278	0.08
279	0.08
280	0.08
281	0.07
282	0.07
283	0.07
284	0.06
285	0.07
286	0.07
287	0.09
288	0.1
289	0.11
290	0.11
291	0.1
292	0.1
293	0.1
294	0.09
295	0.07
296	0.07
297	0.06
298	0.06
299	0.06
300	0.05
301	0.05
302	0.06
303	0.07
304	0.07
305	0.08
306	0.15
307	0.19
308	0.24
309	0.26
310	0.31
311	0.35
312	0.37
313	0.42
314	0.36
315	0.35
316	0.38
317	0.43
318	0.39
319	0.37
320	0.36
321	0.31
322	0.3
323	0.28
324	0.21
325	0.19
326	0.16
327	0.15
328	0.16
329	0.16
330	0.16
331	0.17
332	0.18
333	0.13
334	0.16
335	0.15
336	0.13
337	0.12
338	0.11
339	0.11
340	0.08
341	0.1
342	0.11
343	0.15
344	0.15
345	0.16
346	0.18
347	0.19
348	0.22
349	0.23
350	0.2
351	0.17
352	0.21
353	0.22
354	0.22
355	0.23
356	0.2
357	0.24
358	0.25
359	0.24
360	0.24
361	0.25
362	0.23
363	0.22
364	0.24
365	0.19
366	0.23
367	0.24
368	0.25
369	0.28
370	0.32
371	0.32
372	0.36
373	0.42
374	0.4
375	0.47
376	0.43
377	0.43
378	0.43
379	0.46
380	0.45
381	0.41
382	0.41
383	0.4
384	0.42
385	0.38
386	0.37
387	0.33
388	0.27
389	0.27
390	0.25
391	0.21
392	0.19
393	0.16
394	0.14
395	0.17
396	0.18
397	0.15
398	0.14
399	0.14
400	0.13
401	0.15
402	0.15
403	0.12
404	0.12
405	0.11
406	0.13
407	0.13
408	0.12
409	0.1
410	0.11
411	0.11
412	0.13
413	0.13
414	0.12
415	0.16
416	0.18
417	0.23
418	0.25
419	0.27
420	0.27
421	0.33
422	0.4
423	0.41
424	0.46
425	0.48
426	0.52
427	0.61
428	0.62
429	0.59
430	0.52
431	0.51
432	0.46

L8X975

3D AlphaFold-predicted Structure Viewer