Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8X6J0

Protein Details
Accession L8X6J0    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGRLRRSRVHKAQRDVHRARTRBasic
68-93AALRSHWKSKVHKRRCKQLKEPAYTIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences MGRLRRSRVHKAQRDVHRARTRDLDQIQLHDLDPAVRAKLEAQPIDVEKPGLAQHYCVECAKYYETDAALRSHWKSKVHKRRCKQLKEPAYTIEEAERAGGLGREVRKRPNTDATAAAPDMELIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.82
3 0.81
4 0.79
5 0.72
6 0.66
7 0.65
8 0.57
9 0.56
10 0.52
11 0.5
12 0.42
13 0.43
14 0.41
15 0.34
16 0.31
17 0.23
18 0.21
19 0.13
20 0.13
21 0.11
22 0.1
23 0.09
24 0.09
25 0.1
26 0.14
27 0.18
28 0.16
29 0.16
30 0.18
31 0.19
32 0.21
33 0.19
34 0.15
35 0.11
36 0.11
37 0.11
38 0.11
39 0.1
40 0.09
41 0.11
42 0.12
43 0.14
44 0.13
45 0.13
46 0.11
47 0.13
48 0.13
49 0.11
50 0.11
51 0.1
52 0.1
53 0.11
54 0.12
55 0.11
56 0.11
57 0.13
58 0.14
59 0.18
60 0.2
61 0.25
62 0.33
63 0.43
64 0.54
65 0.62
66 0.71
67 0.73
68 0.81
69 0.85
70 0.86
71 0.85
72 0.85
73 0.84
74 0.81
75 0.76
76 0.69
77 0.62
78 0.53
79 0.44
80 0.35
81 0.25
82 0.18
83 0.16
84 0.12
85 0.08
86 0.08
87 0.07
88 0.06
89 0.11
90 0.16
91 0.23
92 0.26
93 0.35
94 0.42
95 0.47
96 0.52
97 0.57
98 0.56
99 0.53
100 0.54
101 0.49
102 0.46
103 0.41
104 0.35
105 0.25