Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8WHD4

Protein Details
Accession L8WHD4    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-36HPSSYQQSDRKRVRRGCRWSKRVYRDVYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 12, mito 6, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSQREHHIHPSSYQQSDRKRVRRGCRWSKRVYRDVYGGERTLERLTYEDRLRVAPNTRFIRRHGYSIFNTRALLWLISRAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.51
3 0.59
4 0.66
5 0.65
6 0.69
7 0.73
8 0.78
9 0.81
10 0.83
11 0.85
12 0.86
13 0.85
14 0.86
15 0.86
16 0.85
17 0.82
18 0.76
19 0.67
20 0.6
21 0.56
22 0.5
23 0.42
24 0.34
25 0.27
26 0.23
27 0.21
28 0.17
29 0.14
30 0.1
31 0.09
32 0.1
33 0.14
34 0.15
35 0.15
36 0.16
37 0.17
38 0.18
39 0.2
40 0.25
41 0.24
42 0.32
43 0.37
44 0.41
45 0.42
46 0.44
47 0.5
48 0.46
49 0.48
50 0.43
51 0.43
52 0.43
53 0.49
54 0.5
55 0.42
56 0.41
57 0.35
58 0.34
59 0.29
60 0.25
61 0.17