Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8WGK3

Protein Details
Accession L8WGK3   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
127-146NGERSRKREGDDRKSKKPRTBasic
NLS Segment(s)
PositionSequence
114-146LQRIIKKKLGKSDNGERSRKREGDDRKSKKPRT
Subcellular Location(s) nucl 18.5, cyto_nucl 14, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011709  DEAD-box_helicase_OB_fold  
Pfam View protein in Pfam  
PF07717  OB_NTP_bind  
Amino Acid Sequences MERFDLDLVSIQDERKRSLGVRQALVCGFFMQVAHKGDKNTYTTVKDHQVVGLHPSCGLDSTPEWVLFNEFVLTTRPFIRTVVEIRPEWYALLEHAGMYYDLNTFPDSEAKRSLQRIIKKKLGKSDNGERSRKREGDDRKSKKPRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.24
4 0.22
5 0.29
6 0.36
7 0.38
8 0.42
9 0.4
10 0.41
11 0.39
12 0.39
13 0.31
14 0.23
15 0.17
16 0.12
17 0.11
18 0.1
19 0.14
20 0.16
21 0.18
22 0.19
23 0.2
24 0.22
25 0.25
26 0.26
27 0.25
28 0.26
29 0.27
30 0.27
31 0.3
32 0.33
33 0.31
34 0.28
35 0.26
36 0.24
37 0.21
38 0.24
39 0.22
40 0.17
41 0.15
42 0.15
43 0.13
44 0.12
45 0.12
46 0.08
47 0.07
48 0.09
49 0.1
50 0.1
51 0.1
52 0.1
53 0.11
54 0.09
55 0.09
56 0.07
57 0.06
58 0.06
59 0.08
60 0.09
61 0.09
62 0.1
63 0.11
64 0.11
65 0.12
66 0.12
67 0.12
68 0.15
69 0.18
70 0.2
71 0.19
72 0.2
73 0.21
74 0.2
75 0.17
76 0.15
77 0.11
78 0.07
79 0.09
80 0.08
81 0.06
82 0.06
83 0.07
84 0.06
85 0.06
86 0.06
87 0.05
88 0.06
89 0.07
90 0.07
91 0.07
92 0.08
93 0.14
94 0.15
95 0.17
96 0.21
97 0.23
98 0.27
99 0.29
100 0.36
101 0.37
102 0.44
103 0.52
104 0.56
105 0.62
106 0.65
107 0.68
108 0.7
109 0.7
110 0.68
111 0.66
112 0.69
113 0.71
114 0.72
115 0.76
116 0.7
117 0.7
118 0.73
119 0.68
120 0.61
121 0.6
122 0.62
123 0.65
124 0.71
125 0.73
126 0.75