Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8WZ81

Protein Details
Accession L8WZ81    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
9-29FSSTGPCKKKNAKSRCIYYNTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, mito_nucl 12.833, nucl 10.5, cyto_nucl 7.166
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSQTDKLYFSSTGPCKKKNAKSRCIYYNTSPGPRRTSISVLSFSSYKRSYLYAHNVCFIFPVSGCRFIVANYVYPNFTWLLMSRGRWRWCIHGVCVHSYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.52
3 0.61
4 0.69
5 0.7
6 0.74
7 0.74
8 0.77
9 0.81
10 0.81
11 0.78
12 0.73
13 0.67
14 0.66
15 0.61
16 0.6
17 0.56
18 0.51
19 0.5
20 0.47
21 0.44
22 0.38
23 0.36
24 0.32
25 0.31
26 0.3
27 0.25
28 0.25
29 0.23
30 0.2
31 0.22
32 0.18
33 0.16
34 0.14
35 0.15
36 0.16
37 0.2
38 0.29
39 0.29
40 0.29
41 0.32
42 0.31
43 0.29
44 0.27
45 0.23
46 0.14
47 0.09
48 0.14
49 0.13
50 0.16
51 0.16
52 0.16
53 0.16
54 0.16
55 0.2
56 0.16
57 0.17
58 0.16
59 0.18
60 0.17
61 0.17
62 0.18
63 0.14
64 0.13
65 0.12
66 0.1
67 0.13
68 0.15
69 0.18
70 0.25
71 0.32
72 0.36
73 0.39
74 0.41
75 0.43
76 0.49
77 0.51
78 0.47
79 0.47
80 0.47