Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8WGA4

Protein Details
Accession L8WGA4    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
57-79NSASNRKKDRGAKKRRMCLPRTSHydrophilic
NLS Segment(s)
PositionSequence
62-72RKKDRGAKKRR
Subcellular Location(s) mito_nucl 12.833, mito 12.5, nucl 12, cyto_nucl 7.333
Family & Domain DBs
Amino Acid Sequences MTPSRHFYTPYVSAHHRIKFYPSSHEPFALLLQPPPQSHPKLDDATLPRSKEVYSQNSASNRKKDRGAKKRRMCLPRTSYVLGRLRPDWERWT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.49
3 0.44
4 0.39
5 0.42
6 0.43
7 0.41
8 0.43
9 0.43
10 0.44
11 0.44
12 0.43
13 0.38
14 0.32
15 0.31
16 0.25
17 0.19
18 0.14
19 0.15
20 0.17
21 0.17
22 0.19
23 0.23
24 0.22
25 0.23
26 0.25
27 0.27
28 0.26
29 0.26
30 0.28
31 0.26
32 0.31
33 0.33
34 0.3
35 0.26
36 0.25
37 0.24
38 0.24
39 0.27
40 0.26
41 0.26
42 0.27
43 0.32
44 0.38
45 0.45
46 0.46
47 0.48
48 0.48
49 0.48
50 0.53
51 0.58
52 0.62
53 0.66
54 0.72
55 0.74
56 0.79
57 0.85
58 0.87
59 0.87
60 0.8
61 0.8
62 0.76
63 0.73
64 0.7
65 0.64
66 0.57
67 0.57
68 0.59
69 0.52
70 0.49
71 0.43
72 0.42
73 0.42