Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8WY97

Protein Details
Accession L8WY97    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
44-64IICCRCGSRRRSGGRSRARTYHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 17, mito 5, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGSVCSAIGRAINSVISAIAHVFMAIVGGITSVLVSIWNFFLDIICCRCGSRRRSGGRSRARTY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.07
4 0.07
5 0.06
6 0.05
7 0.05
8 0.04
9 0.04
10 0.04
11 0.04
12 0.03
13 0.03
14 0.02
15 0.02
16 0.02
17 0.02
18 0.02
19 0.02
20 0.02
21 0.02
22 0.03
23 0.03
24 0.04
25 0.04
26 0.04
27 0.04
28 0.05
29 0.06
30 0.09
31 0.11
32 0.12
33 0.12
34 0.13
35 0.19
36 0.27
37 0.31
38 0.39
39 0.46
40 0.54
41 0.63
42 0.72
43 0.77
44 0.8