Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8WPL6

Protein Details
Accession L8WPL6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
165-196DQRGAVYRISRHKKRRREKGGRGEPKRVRRTWBasic
NLS Segment(s)
PositionSequence
173-194ISRHKKRRREKGGRGEPKRVRR
Subcellular Location(s) extr 17, plas 5, E.R. 3
Family & Domain DBs
Amino Acid Sequences MRPGPTVVLILCSAIMVLSSPAPPCDLTPAGCPCTYSSCVQECCKRVGCNGGGKSESNACIQVGLTLSFAYPPTHDLSGYHGPTRLAASNIAQRASSLGKILYARSDIDAVLSPGSTRPAKARAIPVQQGDSSQRSRDGLYNNQILPKQGVSLGNAMQIMWTRGDQRGAVYRISRHKKRRREKGGRGEPKRVRRTWRVGMIETASEKGEMEKNEFGLGLGGSCVTCDGHEGRREGHEAWVLAFARMVLESATDACDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.05
4 0.05
5 0.06
6 0.08
7 0.09
8 0.1
9 0.12
10 0.12
11 0.12
12 0.18
13 0.18
14 0.18
15 0.24
16 0.28
17 0.3
18 0.3
19 0.3
20 0.26
21 0.3
22 0.31
23 0.27
24 0.27
25 0.3
26 0.34
27 0.39
28 0.45
29 0.42
30 0.45
31 0.48
32 0.44
33 0.41
34 0.44
35 0.43
36 0.45
37 0.45
38 0.43
39 0.39
40 0.38
41 0.38
42 0.34
43 0.31
44 0.23
45 0.21
46 0.17
47 0.16
48 0.15
49 0.14
50 0.11
51 0.1
52 0.09
53 0.08
54 0.08
55 0.08
56 0.09
57 0.08
58 0.07
59 0.09
60 0.12
61 0.12
62 0.12
63 0.12
64 0.18
65 0.24
66 0.26
67 0.25
68 0.23
69 0.22
70 0.23
71 0.25
72 0.2
73 0.13
74 0.13
75 0.14
76 0.18
77 0.19
78 0.19
79 0.16
80 0.15
81 0.16
82 0.16
83 0.14
84 0.1
85 0.08
86 0.1
87 0.11
88 0.11
89 0.1
90 0.1
91 0.1
92 0.1
93 0.11
94 0.08
95 0.09
96 0.09
97 0.08
98 0.07
99 0.06
100 0.06
101 0.06
102 0.09
103 0.08
104 0.08
105 0.1
106 0.14
107 0.16
108 0.18
109 0.24
110 0.27
111 0.31
112 0.33
113 0.32
114 0.3
115 0.29
116 0.27
117 0.24
118 0.22
119 0.19
120 0.16
121 0.16
122 0.15
123 0.16
124 0.18
125 0.2
126 0.22
127 0.25
128 0.29
129 0.28
130 0.3
131 0.29
132 0.26
133 0.24
134 0.18
135 0.14
136 0.12
137 0.12
138 0.11
139 0.12
140 0.12
141 0.12
142 0.12
143 0.11
144 0.09
145 0.09
146 0.09
147 0.07
148 0.08
149 0.09
150 0.1
151 0.11
152 0.11
153 0.12
154 0.18
155 0.19
156 0.21
157 0.21
158 0.25
159 0.34
160 0.43
161 0.51
162 0.55
163 0.63
164 0.71
165 0.8
166 0.86
167 0.88
168 0.9
169 0.91
170 0.92
171 0.94
172 0.94
173 0.89
174 0.89
175 0.85
176 0.85
177 0.83
178 0.77
179 0.74
180 0.72
181 0.74
182 0.73
183 0.73
184 0.68
185 0.61
186 0.59
187 0.52
188 0.45
189 0.38
190 0.3
191 0.21
192 0.16
193 0.15
194 0.14
195 0.16
196 0.15
197 0.19
198 0.19
199 0.2
200 0.2
201 0.2
202 0.17
203 0.14
204 0.13
205 0.08
206 0.07
207 0.06
208 0.06
209 0.06
210 0.06
211 0.05
212 0.05
213 0.08
214 0.11
215 0.17
216 0.23
217 0.25
218 0.26
219 0.3
220 0.33
221 0.31
222 0.33
223 0.3
224 0.26
225 0.25
226 0.29
227 0.26
228 0.23
229 0.22
230 0.17
231 0.14
232 0.13
233 0.12
234 0.06
235 0.06
236 0.07
237 0.08