Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8WXD8

Protein Details
Accession L8WXD8    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
53-79RNSLHEPYKGKKRKRNENKQYRELQKEBasic
NLS Segment(s)
PositionSequence
61-68KGKKRKRN
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 6
Family & Domain DBs
Amino Acid Sequences MTKARHRLETGRSKVEEYYIQYDGLWCMCSNGMVANERGGDIIQGQMDGTETRNSLHEPYKGKKRKRNENKQYRELQKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.47
3 0.41
4 0.35
5 0.33
6 0.26
7 0.25
8 0.23
9 0.23
10 0.2
11 0.17
12 0.13
13 0.08
14 0.08
15 0.08
16 0.08
17 0.07
18 0.08
19 0.09
20 0.09
21 0.1
22 0.1
23 0.1
24 0.09
25 0.09
26 0.08
27 0.06
28 0.05
29 0.05
30 0.04
31 0.04
32 0.04
33 0.04
34 0.05
35 0.05
36 0.07
37 0.07
38 0.07
39 0.08
40 0.1
41 0.11
42 0.14
43 0.18
44 0.21
45 0.26
46 0.33
47 0.44
48 0.52
49 0.6
50 0.66
51 0.72
52 0.79
53 0.84
54 0.89
55 0.89
56 0.91
57 0.92
58 0.92
59 0.92