Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8WC46

Protein Details
Accession L8WC46    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
8-33RTPHHHRSSTSSKPRRRSQQLSAEVRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MVYSPYYRTPHHHRSSTSSKPRRRSQQLSAEVRADIVARVLDPAYSGRARDNYSSRVFIDPNGDEHDPDYQLFPTIYPAPSRHRHTASSGFFRRRRCLDHRLDT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.68
3 0.72
4 0.73
5 0.73
6 0.72
7 0.75
8 0.81
9 0.84
10 0.84
11 0.81
12 0.79
13 0.8
14 0.81
15 0.79
16 0.72
17 0.63
18 0.53
19 0.45
20 0.36
21 0.26
22 0.16
23 0.1
24 0.06
25 0.05
26 0.06
27 0.05
28 0.05
29 0.05
30 0.06
31 0.08
32 0.09
33 0.09
34 0.1
35 0.13
36 0.14
37 0.17
38 0.19
39 0.21
40 0.23
41 0.24
42 0.23
43 0.23
44 0.22
45 0.19
46 0.21
47 0.17
48 0.17
49 0.19
50 0.18
51 0.16
52 0.17
53 0.18
54 0.14
55 0.14
56 0.13
57 0.09
58 0.1
59 0.1
60 0.1
61 0.11
62 0.13
63 0.14
64 0.15
65 0.18
66 0.24
67 0.32
68 0.38
69 0.42
70 0.44
71 0.45
72 0.49
73 0.55
74 0.55
75 0.57
76 0.59
77 0.61
78 0.62
79 0.65
80 0.67
81 0.64
82 0.65
83 0.62
84 0.64