Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8X7U3

Protein Details
Accession L8X7U3   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
16-41VGPESVEKRSRKRSKRRQAIGQVDLPHydrophilic
NLS Segment(s)
PositionSequence
23-32KRSRKRSKRR
Subcellular Location(s) mito 11.5, cyto_mito 9.833, cyto 7, cyto_nucl 5.833, nucl 3.5, pero 3
Family & Domain DBs
Amino Acid Sequences MSGPRDRNGKPIATEVGPESVEKRSRKRSKRRQAIGQVDLPIRATQGVFASSIRMGLLFAVPSHDFPVFVCRRSAGPNDPPNSAVWIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.28
3 0.26
4 0.22
5 0.2
6 0.18
7 0.19
8 0.25
9 0.28
10 0.33
11 0.42
12 0.52
13 0.62
14 0.72
15 0.77
16 0.82
17 0.89
18 0.9
19 0.89
20 0.89
21 0.87
22 0.8
23 0.72
24 0.64
25 0.53
26 0.45
27 0.36
28 0.25
29 0.17
30 0.12
31 0.09
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.07
38 0.07
39 0.07
40 0.06
41 0.06
42 0.05
43 0.05
44 0.05
45 0.04
46 0.04
47 0.08
48 0.08
49 0.09
50 0.11
51 0.11
52 0.1
53 0.11
54 0.21
55 0.2
56 0.21
57 0.21
58 0.2
59 0.22
60 0.27
61 0.32
62 0.3
63 0.38
64 0.45
65 0.47
66 0.48
67 0.47
68 0.43