Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8WXD1

Protein Details
Accession L8WXD1    Localization Confidence High Confidence Score 17.8
NoLS Segment(s)
PositionSequenceProtein Nature
365-401ASKGVDRKDRISRKRIPKGKKRVMRTRRVKNAKGYMVBasic
NLS Segment(s)
PositionSequence
306-307RK
359-396KAAKAEASKGVDRKDRISRKRIPKGKKRVMRTRRVKNA
Subcellular Location(s) nucl 21, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR019038  POLD3  
IPR041913  POLD3_sf  
Gene Ontology GO:0043625  C:delta DNA polymerase complex  
GO:0006260  P:DNA replication  
Pfam View protein in Pfam  
PF09507  CDC27  
Amino Acid Sequences MASKAATDFLTKEVTFRLLSRQLSIHVAEAKRELELFYKVAKQNKEPVFATYILTGTAAFETNEGPAEQVPRHLILLANEEEIDVATKIKFAQPPSQHIYSVSPVPLKDHSLLTSATDRVRQLDKQKGRAHASQMGMLLSEEAPVSRSSFPKRVGIEAKKDTPISNTIKGEAVTKLKASSSDVPPPTKNGARQNLLSFGTKKPTTGNKPKETSEATEKKTLATKSTIGKDRAEEDPVDRKISPQAVRPKEVPKPPSAASSRDSTTEPSRTIAAPLHKSGARSKRILDSDEDDSEPAQGHSRPAIKRKKSRTTDEDDDDMELSKKPDTAGLQTMMDIDDGKYLSGLQHVPSAREAAASAKAAKAEASKGVDRKDRISRKRIPKGKKRVMRTRRVKNAKGYMVTEDYSSYEDADPNDSEKDNDTDAQSETDYGDDIDVDVSGKVVSTQGTKPVAKPLNNQPKRHSESLPNTKLKKGKSNDASKPGQQKLANFFGKKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.22
4 0.28
5 0.29
6 0.31
7 0.33
8 0.32
9 0.32
10 0.35
11 0.34
12 0.31
13 0.31
14 0.3
15 0.29
16 0.31
17 0.29
18 0.26
19 0.25
20 0.22
21 0.18
22 0.2
23 0.2
24 0.2
25 0.28
26 0.32
27 0.38
28 0.42
29 0.44
30 0.5
31 0.54
32 0.57
33 0.5
34 0.48
35 0.46
36 0.42
37 0.38
38 0.3
39 0.24
40 0.18
41 0.17
42 0.14
43 0.1
44 0.1
45 0.09
46 0.08
47 0.08
48 0.09
49 0.09
50 0.1
51 0.09
52 0.09
53 0.1
54 0.13
55 0.13
56 0.16
57 0.17
58 0.17
59 0.18
60 0.18
61 0.18
62 0.16
63 0.21
64 0.2
65 0.18
66 0.17
67 0.16
68 0.15
69 0.14
70 0.13
71 0.08
72 0.08
73 0.07
74 0.08
75 0.09
76 0.14
77 0.17
78 0.19
79 0.29
80 0.33
81 0.4
82 0.46
83 0.48
84 0.43
85 0.41
86 0.41
87 0.35
88 0.33
89 0.28
90 0.24
91 0.21
92 0.24
93 0.24
94 0.24
95 0.23
96 0.22
97 0.2
98 0.2
99 0.2
100 0.2
101 0.21
102 0.2
103 0.19
104 0.21
105 0.2
106 0.21
107 0.25
108 0.27
109 0.32
110 0.4
111 0.45
112 0.52
113 0.57
114 0.61
115 0.63
116 0.62
117 0.6
118 0.56
119 0.5
120 0.44
121 0.39
122 0.31
123 0.25
124 0.21
125 0.17
126 0.1
127 0.09
128 0.06
129 0.05
130 0.07
131 0.07
132 0.1
133 0.11
134 0.15
135 0.2
136 0.26
137 0.28
138 0.33
139 0.34
140 0.38
141 0.44
142 0.47
143 0.5
144 0.5
145 0.51
146 0.48
147 0.48
148 0.42
149 0.35
150 0.36
151 0.33
152 0.33
153 0.3
154 0.28
155 0.29
156 0.28
157 0.28
158 0.24
159 0.21
160 0.17
161 0.16
162 0.16
163 0.15
164 0.15
165 0.18
166 0.21
167 0.22
168 0.29
169 0.32
170 0.34
171 0.35
172 0.37
173 0.38
174 0.35
175 0.36
176 0.37
177 0.4
178 0.4
179 0.42
180 0.4
181 0.39
182 0.37
183 0.34
184 0.28
185 0.23
186 0.26
187 0.24
188 0.23
189 0.24
190 0.3
191 0.37
192 0.45
193 0.53
194 0.54
195 0.58
196 0.59
197 0.59
198 0.53
199 0.47
200 0.47
201 0.45
202 0.4
203 0.42
204 0.4
205 0.37
206 0.4
207 0.36
208 0.28
209 0.24
210 0.24
211 0.24
212 0.3
213 0.35
214 0.32
215 0.32
216 0.31
217 0.31
218 0.3
219 0.27
220 0.21
221 0.18
222 0.23
223 0.23
224 0.24
225 0.21
226 0.2
227 0.22
228 0.27
229 0.25
230 0.25
231 0.34
232 0.35
233 0.38
234 0.4
235 0.42
236 0.43
237 0.47
238 0.43
239 0.35
240 0.36
241 0.34
242 0.38
243 0.35
244 0.31
245 0.27
246 0.28
247 0.26
248 0.24
249 0.23
250 0.2
251 0.22
252 0.21
253 0.2
254 0.18
255 0.18
256 0.17
257 0.17
258 0.18
259 0.19
260 0.19
261 0.19
262 0.21
263 0.21
264 0.23
265 0.29
266 0.34
267 0.33
268 0.32
269 0.33
270 0.37
271 0.38
272 0.38
273 0.33
274 0.29
275 0.28
276 0.29
277 0.27
278 0.2
279 0.18
280 0.17
281 0.15
282 0.11
283 0.09
284 0.08
285 0.09
286 0.12
287 0.18
288 0.21
289 0.3
290 0.4
291 0.47
292 0.56
293 0.65
294 0.72
295 0.73
296 0.78
297 0.76
298 0.75
299 0.73
300 0.68
301 0.61
302 0.51
303 0.44
304 0.36
305 0.29
306 0.21
307 0.15
308 0.12
309 0.1
310 0.1
311 0.09
312 0.12
313 0.13
314 0.15
315 0.17
316 0.18
317 0.18
318 0.17
319 0.18
320 0.15
321 0.13
322 0.1
323 0.07
324 0.07
325 0.07
326 0.07
327 0.07
328 0.06
329 0.07
330 0.09
331 0.1
332 0.09
333 0.14
334 0.14
335 0.16
336 0.16
337 0.18
338 0.15
339 0.15
340 0.14
341 0.11
342 0.13
343 0.13
344 0.13
345 0.12
346 0.13
347 0.12
348 0.13
349 0.12
350 0.12
351 0.14
352 0.18
353 0.21
354 0.24
355 0.29
356 0.34
357 0.35
358 0.39
359 0.46
360 0.52
361 0.56
362 0.62
363 0.67
364 0.72
365 0.81
366 0.84
367 0.85
368 0.85
369 0.88
370 0.9
371 0.88
372 0.87
373 0.88
374 0.89
375 0.89
376 0.89
377 0.88
378 0.89
379 0.9
380 0.87
381 0.85
382 0.84
383 0.8
384 0.73
385 0.64
386 0.58
387 0.51
388 0.45
389 0.36
390 0.27
391 0.22
392 0.19
393 0.17
394 0.14
395 0.12
396 0.13
397 0.14
398 0.16
399 0.16
400 0.17
401 0.19
402 0.17
403 0.17
404 0.19
405 0.2
406 0.19
407 0.2
408 0.2
409 0.19
410 0.2
411 0.2
412 0.18
413 0.16
414 0.14
415 0.12
416 0.11
417 0.09
418 0.08
419 0.07
420 0.07
421 0.06
422 0.06
423 0.06
424 0.06
425 0.06
426 0.05
427 0.05
428 0.05
429 0.06
430 0.08
431 0.11
432 0.13
433 0.2
434 0.26
435 0.28
436 0.29
437 0.38
438 0.44
439 0.44
440 0.5
441 0.54
442 0.6
443 0.66
444 0.7
445 0.67
446 0.7
447 0.74
448 0.72
449 0.66
450 0.65
451 0.68
452 0.74
453 0.76
454 0.75
455 0.7
456 0.72
457 0.73
458 0.69
459 0.68
460 0.64
461 0.65
462 0.66
463 0.74
464 0.76
465 0.78
466 0.78
467 0.76
468 0.78
469 0.72
470 0.7
471 0.62
472 0.59
473 0.58
474 0.62
475 0.62