Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8WF42

Protein Details
Accession L8WF42    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
21-41SSRSSRADRRREVRKRTRWTLHydrophilic
NLS Segment(s)
PositionSequence
27-36ADRRREVRKR
Subcellular Location(s) mito 11, nucl 6, extr 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MGPFSLARLVSAMAFNLVRASSRSSRADRRREVRKRTRWTLLGRTRQGNDTEYREFQKTWPNSRQIGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.09
5 0.08
6 0.09
7 0.15
8 0.16
9 0.21
10 0.26
11 0.3
12 0.4
13 0.48
14 0.56
15 0.58
16 0.63
17 0.69
18 0.73
19 0.78
20 0.79
21 0.8
22 0.8
23 0.78
24 0.77
25 0.73
26 0.7
27 0.7
28 0.69
29 0.68
30 0.64
31 0.62
32 0.57
33 0.54
34 0.5
35 0.43
36 0.38
37 0.34
38 0.35
39 0.33
40 0.35
41 0.35
42 0.33
43 0.33
44 0.39
45 0.4
46 0.44
47 0.49
48 0.52