Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8X913

Protein Details
Accession L8X913    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
9-30GNPTPARVRPQKKTRIRTPPEAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MTEIRPSNGNPTPARVRPQKKTRIRTPPEAGLSHPYPNRAYLPPVGYGFPGIRPPGSDYP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.52
3 0.55
4 0.59
5 0.68
6 0.72
7 0.74
8 0.79
9 0.82
10 0.83
11 0.81
12 0.8
13 0.75
14 0.71
15 0.65
16 0.56
17 0.48
18 0.42
19 0.37
20 0.33
21 0.28
22 0.24
23 0.21
24 0.22
25 0.25
26 0.21
27 0.22
28 0.22
29 0.23
30 0.24
31 0.24
32 0.23
33 0.2
34 0.21
35 0.19
36 0.17
37 0.19
38 0.17
39 0.16
40 0.18