Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8WCC9

Protein Details
Accession L8WCC9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
79-107KVHPAQRQVREPRCPPRPRRRFQDQRNRRBasic
NLS Segment(s)
PositionSequence
94-100PRPRRRF
Subcellular Location(s) mito 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR027413  GROEL-like_equatorial_sf  
Amino Acid Sequences MHRSTSMMRTSLSGLPRSARSLVLSRGAHKEVKFSNEGRAAMLKGVDILAKAVSVTLGPKGVSGLCDMIQPYGGPKITKVHPAQRQVREPRCPPRPRRRFQDQRNRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.28
4 0.3
5 0.27
6 0.23
7 0.23
8 0.24
9 0.25
10 0.3
11 0.29
12 0.29
13 0.33
14 0.34
15 0.35
16 0.31
17 0.34
18 0.29
19 0.32
20 0.32
21 0.29
22 0.32
23 0.32
24 0.32
25 0.27
26 0.26
27 0.22
28 0.19
29 0.18
30 0.11
31 0.07
32 0.07
33 0.06
34 0.05
35 0.05
36 0.04
37 0.04
38 0.04
39 0.03
40 0.03
41 0.03
42 0.04
43 0.04
44 0.05
45 0.05
46 0.05
47 0.06
48 0.06
49 0.06
50 0.07
51 0.07
52 0.07
53 0.08
54 0.08
55 0.08
56 0.08
57 0.07
58 0.08
59 0.1
60 0.11
61 0.1
62 0.11
63 0.16
64 0.18
65 0.27
66 0.3
67 0.36
68 0.42
69 0.52
70 0.6
71 0.63
72 0.7
73 0.72
74 0.76
75 0.75
76 0.76
77 0.77
78 0.78
79 0.8
80 0.82
81 0.83
82 0.86
83 0.86
84 0.87
85 0.88
86 0.89
87 0.9