Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8X458

Protein Details
Accession L8X458    Localization Confidence Low Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
94-118WPIYRRVSCRKVRAHRRGVPKTKGYHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11, cyto_nucl 9.833, mito 9, cyto_pero 6.999, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036859  CAP-Gly_dom_sf  
IPR000938  CAP-Gly_domain  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
Pfam View protein in Pfam  
PF14560  Ubiquitin_2  
Amino Acid Sequences MSTIRVHVLSPDTFSERKYDLHMTIGQLKGKLESVTGIAPESQRLTVHRSIDEQNSAPLHVLDDDSGGGTIKESQPRRLIIPKGGGYQYQLFDWPIYRRVSCRKVRAHRRGVPKTKGYWKSTKFIDPLLRARLIDTVLAYKQANKIGRFADSAQAPEIHVYTASPEIKPGARCKVETEGDGDIKRGVVRFVGPTKFGKEVVIGLVSNMMNQWVKMTARKHPLVLGRGHLLILEFSVQGERYFTCPAKHGAFVRPDRITVGDFPPVDPFADEQFEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.29
3 0.26
4 0.26
5 0.29
6 0.3
7 0.26
8 0.3
9 0.32
10 0.32
11 0.37
12 0.39
13 0.36
14 0.32
15 0.31
16 0.28
17 0.28
18 0.24
19 0.17
20 0.15
21 0.14
22 0.14
23 0.14
24 0.13
25 0.13
26 0.13
27 0.14
28 0.15
29 0.14
30 0.14
31 0.16
32 0.21
33 0.25
34 0.27
35 0.27
36 0.29
37 0.32
38 0.35
39 0.37
40 0.31
41 0.3
42 0.28
43 0.26
44 0.23
45 0.19
46 0.15
47 0.12
48 0.12
49 0.08
50 0.08
51 0.08
52 0.07
53 0.07
54 0.06
55 0.06
56 0.05
57 0.08
58 0.11
59 0.18
60 0.2
61 0.25
62 0.29
63 0.31
64 0.35
65 0.39
66 0.39
67 0.37
68 0.42
69 0.39
70 0.39
71 0.38
72 0.34
73 0.3
74 0.3
75 0.26
76 0.19
77 0.18
78 0.14
79 0.14
80 0.16
81 0.15
82 0.17
83 0.18
84 0.19
85 0.22
86 0.3
87 0.38
88 0.43
89 0.49
90 0.55
91 0.63
92 0.73
93 0.79
94 0.81
95 0.79
96 0.83
97 0.85
98 0.84
99 0.8
100 0.74
101 0.7
102 0.7
103 0.69
104 0.64
105 0.63
106 0.57
107 0.55
108 0.53
109 0.52
110 0.43
111 0.4
112 0.4
113 0.35
114 0.35
115 0.34
116 0.32
117 0.27
118 0.27
119 0.23
120 0.18
121 0.14
122 0.11
123 0.09
124 0.08
125 0.1
126 0.09
127 0.1
128 0.12
129 0.16
130 0.2
131 0.18
132 0.21
133 0.2
134 0.21
135 0.22
136 0.2
137 0.2
138 0.16
139 0.16
140 0.15
141 0.14
142 0.13
143 0.12
144 0.11
145 0.07
146 0.06
147 0.05
148 0.06
149 0.1
150 0.11
151 0.1
152 0.1
153 0.12
154 0.15
155 0.18
156 0.2
157 0.24
158 0.24
159 0.25
160 0.28
161 0.33
162 0.31
163 0.3
164 0.29
165 0.24
166 0.25
167 0.25
168 0.22
169 0.16
170 0.15
171 0.15
172 0.12
173 0.1
174 0.08
175 0.09
176 0.12
177 0.17
178 0.19
179 0.2
180 0.22
181 0.25
182 0.26
183 0.25
184 0.21
185 0.17
186 0.16
187 0.15
188 0.15
189 0.11
190 0.1
191 0.12
192 0.12
193 0.11
194 0.1
195 0.1
196 0.09
197 0.09
198 0.1
199 0.1
200 0.12
201 0.17
202 0.21
203 0.27
204 0.35
205 0.37
206 0.37
207 0.39
208 0.44
209 0.44
210 0.43
211 0.39
212 0.33
213 0.32
214 0.3
215 0.25
216 0.19
217 0.14
218 0.12
219 0.1
220 0.07
221 0.07
222 0.08
223 0.09
224 0.08
225 0.1
226 0.1
227 0.12
228 0.18
229 0.19
230 0.2
231 0.22
232 0.27
233 0.29
234 0.33
235 0.34
236 0.36
237 0.43
238 0.47
239 0.51
240 0.48
241 0.45
242 0.42
243 0.41
244 0.36
245 0.31
246 0.29
247 0.29
248 0.27
249 0.27
250 0.29
251 0.28
252 0.25
253 0.22
254 0.21
255 0.18