Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8WLZ9

Protein Details
Accession L8WLZ9   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MARIQKRARTKTRAKTSLLPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR045871  AHP1-5/YPD1  
IPR036641  HPT_dom_sf  
IPR008207  Sig_transdc_His_kin_Hpt_dom  
Gene Ontology GO:0009927  F:histidine phosphotransfer kinase activity  
GO:0043424  F:protein histidine kinase binding  
GO:0000160  P:phosphorelay signal transduction system  
Pfam View protein in Pfam  
PF01627  Hpt  
PROSITE View protein in PROSITE  
PS50894  HPT  
CDD cd00088  HPT  
Amino Acid Sequences MARIQKRARTKTRAKTSLLPVFNQITEMDEEDDCEFSSDIVRDYFKQAITTLGELNDALNQKDFATLSSKGHFLKGSSAALGVKKVQESCEHIQHYGHKRDEIKGVDLTEPQALRRIELLMPRLEKDYESAKAWLINYYSNRGVDLEEDDSLVCDPKIDGFIANPASNNRTQQVREAVPGKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.78
3 0.78
4 0.77
5 0.69
6 0.6
7 0.53
8 0.49
9 0.43
10 0.36
11 0.27
12 0.19
13 0.18
14 0.18
15 0.16
16 0.13
17 0.15
18 0.14
19 0.15
20 0.12
21 0.12
22 0.11
23 0.08
24 0.11
25 0.1
26 0.1
27 0.11
28 0.13
29 0.13
30 0.16
31 0.19
32 0.17
33 0.18
34 0.17
35 0.18
36 0.18
37 0.18
38 0.15
39 0.13
40 0.13
41 0.12
42 0.11
43 0.12
44 0.11
45 0.1
46 0.1
47 0.1
48 0.1
49 0.11
50 0.11
51 0.09
52 0.12
53 0.13
54 0.14
55 0.15
56 0.18
57 0.17
58 0.18
59 0.18
60 0.14
61 0.16
62 0.16
63 0.15
64 0.13
65 0.13
66 0.13
67 0.13
68 0.13
69 0.1
70 0.09
71 0.1
72 0.1
73 0.1
74 0.11
75 0.17
76 0.2
77 0.25
78 0.25
79 0.24
80 0.25
81 0.31
82 0.36
83 0.37
84 0.35
85 0.33
86 0.33
87 0.35
88 0.39
89 0.34
90 0.29
91 0.24
92 0.24
93 0.21
94 0.2
95 0.19
96 0.17
97 0.15
98 0.12
99 0.17
100 0.15
101 0.15
102 0.15
103 0.16
104 0.15
105 0.18
106 0.21
107 0.19
108 0.2
109 0.21
110 0.22
111 0.2
112 0.19
113 0.18
114 0.19
115 0.18
116 0.19
117 0.19
118 0.17
119 0.19
120 0.2
121 0.2
122 0.16
123 0.19
124 0.19
125 0.23
126 0.25
127 0.23
128 0.23
129 0.21
130 0.21
131 0.17
132 0.18
133 0.15
134 0.13
135 0.13
136 0.12
137 0.12
138 0.12
139 0.12
140 0.08
141 0.07
142 0.07
143 0.08
144 0.1
145 0.1
146 0.1
147 0.1
148 0.15
149 0.19
150 0.19
151 0.19
152 0.21
153 0.24
154 0.27
155 0.29
156 0.27
157 0.29
158 0.3
159 0.35
160 0.4
161 0.39
162 0.43