Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8X6H1

Protein Details
Accession L8X6H1    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
110-131EFKARVMARRPRKGQGQRKDSGBasic
NLS Segment(s)
PositionSequence
113-132ARVMARRPRKGQGQRKDSGK
Subcellular Location(s) cyto_nucl 10, nucl 9.5, cyto 9.5, mito 4, extr 3
Family & Domain DBs
Amino Acid Sequences MSPTLGDVVAAAVAGDKENHKRLPDIAEKPAAPEGDAIPDDTLAQNNTVLGALGGSHPRSWSLQHPATRASFSKPPRLGAHHPVLEPVTSGDVSIATDPFRADFRPAHSEFKARVMARRPRKGQGQRKDSGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.07
3 0.1
4 0.16
5 0.21
6 0.24
7 0.25
8 0.27
9 0.29
10 0.36
11 0.41
12 0.4
13 0.4
14 0.42
15 0.4
16 0.41
17 0.41
18 0.33
19 0.25
20 0.21
21 0.16
22 0.15
23 0.15
24 0.14
25 0.11
26 0.11
27 0.11
28 0.1
29 0.11
30 0.07
31 0.08
32 0.07
33 0.07
34 0.07
35 0.06
36 0.06
37 0.04
38 0.04
39 0.03
40 0.04
41 0.06
42 0.06
43 0.06
44 0.07
45 0.08
46 0.09
47 0.1
48 0.14
49 0.2
50 0.24
51 0.27
52 0.28
53 0.29
54 0.3
55 0.3
56 0.27
57 0.23
58 0.24
59 0.25
60 0.32
61 0.31
62 0.34
63 0.34
64 0.4
65 0.41
66 0.41
67 0.45
68 0.38
69 0.37
70 0.35
71 0.33
72 0.27
73 0.22
74 0.16
75 0.11
76 0.08
77 0.08
78 0.07
79 0.06
80 0.07
81 0.07
82 0.07
83 0.06
84 0.07
85 0.07
86 0.08
87 0.09
88 0.1
89 0.12
90 0.14
91 0.19
92 0.27
93 0.3
94 0.35
95 0.35
96 0.39
97 0.38
98 0.41
99 0.43
100 0.36
101 0.4
102 0.43
103 0.52
104 0.57
105 0.66
106 0.66
107 0.66
108 0.76
109 0.8
110 0.81
111 0.82
112 0.8