Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8X3R8

Protein Details
Accession L8X3R8    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
43-68PKTGKPGRAGRGRRRKNNNERPAKSABasic
NLS Segment(s)
PositionSequence
32-64AAKATAGGDAKPKTGKPGRAGRGRRRKNNNERP
Subcellular Location(s) nucl 10cyto_nucl 10, mito 8, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR025715  FoP_C  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF13865  FoP_duplication  
Amino Acid Sequences MKIEIVMDPTKVPPPPLASRVAPAPEAKQPAAAKATAGGDAKPKTGKPGRAGRGRRRKNNNERPAKSAADLDAEMEVYKATPDEATA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.3
3 0.31
4 0.34
5 0.31
6 0.32
7 0.34
8 0.33
9 0.28
10 0.24
11 0.23
12 0.23
13 0.26
14 0.24
15 0.26
16 0.24
17 0.25
18 0.25
19 0.22
20 0.18
21 0.15
22 0.16
23 0.13
24 0.13
25 0.11
26 0.14
27 0.14
28 0.16
29 0.15
30 0.14
31 0.19
32 0.23
33 0.27
34 0.29
35 0.38
36 0.44
37 0.52
38 0.61
39 0.65
40 0.71
41 0.77
42 0.8
43 0.81
44 0.85
45 0.87
46 0.9
47 0.9
48 0.9
49 0.84
50 0.79
51 0.74
52 0.65
53 0.55
54 0.45
55 0.36
56 0.28
57 0.25
58 0.2
59 0.15
60 0.14
61 0.12
62 0.1
63 0.09
64 0.06
65 0.06
66 0.06
67 0.06