Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8WU93

Protein Details
Accession L8WU93   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
24-46KKLQCIFPREPRHRKRANKGSSAHydrophilic
NLS Segment(s)
PositionSequence
34-40PRHRKRA
Subcellular Location(s) nucl 12mito 12mito_nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR010613  PES  
Gene Ontology GO:0005730  C:nucleolus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF06732  Pescadillo_N  
Amino Acid Sequences MAKLKQRGKSGAAKAYITRSSAIKKLQCIFPREPRHRKRANKGSSAPTTFYYAKDIAYLTHEPILRKLREHKAFAKKLARRTSLYTHWIIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.48
3 0.44
4 0.36
5 0.3
6 0.26
7 0.26
8 0.29
9 0.33
10 0.31
11 0.34
12 0.37
13 0.43
14 0.45
15 0.47
16 0.49
17 0.52
18 0.6
19 0.64
20 0.71
21 0.71
22 0.76
23 0.79
24 0.82
25 0.83
26 0.83
27 0.8
28 0.78
29 0.75
30 0.72
31 0.67
32 0.6
33 0.51
34 0.41
35 0.39
36 0.31
37 0.27
38 0.23
39 0.18
40 0.16
41 0.16
42 0.15
43 0.1
44 0.14
45 0.15
46 0.13
47 0.16
48 0.18
49 0.18
50 0.24
51 0.3
52 0.27
53 0.3
54 0.37
55 0.43
56 0.48
57 0.53
58 0.57
59 0.61
60 0.65
61 0.7
62 0.72
63 0.67
64 0.7
65 0.74
66 0.69
67 0.62
68 0.63
69 0.62
70 0.59
71 0.6