Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4S0Z6

Protein Details
Accession F4S0Z6   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
80-99SDGRLSFGQKKKKRGLKFRLBasic
NLS Segment(s)
PositionSequence
89-99KKKKRGLKFRL
Subcellular Location(s) nucl 16, cyto_nucl 11.333, mito_nucl 10.833, cyto 5.5, mito 4.5
Family & Domain DBs
KEGG mlr:MELLADRAFT_72933  -  
Amino Acid Sequences MKLFYSDNKQPSVINFKRDSALDKMKLLDVQRDPVTEVEDRRPASFIIGGRTKLISGPIRLDQATQTELLWKMINGTVSSDGRLSFGQKKKKRGLKFRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.39
3 0.39
4 0.4
5 0.4
6 0.39
7 0.36
8 0.4
9 0.35
10 0.34
11 0.34
12 0.32
13 0.35
14 0.31
15 0.31
16 0.24
17 0.26
18 0.26
19 0.25
20 0.25
21 0.22
22 0.24
23 0.19
24 0.2
25 0.18
26 0.22
27 0.22
28 0.22
29 0.22
30 0.19
31 0.18
32 0.19
33 0.15
34 0.16
35 0.17
36 0.17
37 0.16
38 0.17
39 0.15
40 0.13
41 0.16
42 0.14
43 0.12
44 0.15
45 0.16
46 0.18
47 0.18
48 0.18
49 0.15
50 0.15
51 0.15
52 0.13
53 0.11
54 0.12
55 0.13
56 0.14
57 0.13
58 0.11
59 0.12
60 0.13
61 0.14
62 0.11
63 0.13
64 0.16
65 0.16
66 0.17
67 0.16
68 0.15
69 0.15
70 0.16
71 0.18
72 0.23
73 0.31
74 0.41
75 0.47
76 0.57
77 0.65
78 0.74
79 0.8