Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4S0P8

Protein Details
Accession F4S0P8    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
8-37RHKRSASGAKRAHYRKKRKFELGRQPAMTKBasic
NLS Segment(s)
PositionSequence
8-52RHKRSASGAKRAHYRKKRKFELGRQPAMTKLGAKRIHTVRVRGGN
Subcellular Location(s) nucl 16, mito 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR042563  Ribosomal_protein_S8e_euk  
IPR001047  Ribosomal_S8e  
IPR022309  Ribosomal_S8e/biogenesis_NSA2  
IPR018283  Ribosomal_S8e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG mlr:MELLADRAFT_38944  -  
Pfam View protein in Pfam  
PF01201  Ribosomal_S8e  
PROSITE View protein in PROSITE  
PS01193  RIBOSOMAL_S8E  
CDD cd11380  Ribosomal_S8e_like  
Amino Acid Sequences MSISRDSRHKRSASGAKRAHYRKKRKFELGRQPAMTKLGAKRIHTVRVRGGNIKHRALRLESGNFAWGSERVTKKTRVIGVVYNSTNNELVRTNTLVKGAIIQIDATPFRQWYEGHYAQPVTKKGKPTAAGTEAEAPKEKSKAVLKKLEQRKATAKIDQMLETQFQAGRLYASISSRPGQSGRCDGYILEGKELEFYLRRLRSHKQKHAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.66
3 0.64
4 0.71
5 0.77
6 0.78
7 0.78
8 0.8
9 0.81
10 0.85
11 0.89
12 0.9
13 0.92
14 0.91
15 0.92
16 0.91
17 0.89
18 0.81
19 0.73
20 0.65
21 0.56
22 0.47
23 0.41
24 0.34
25 0.34
26 0.35
27 0.35
28 0.41
29 0.42
30 0.5
31 0.49
32 0.49
33 0.48
34 0.52
35 0.53
36 0.51
37 0.53
38 0.53
39 0.55
40 0.57
41 0.53
42 0.47
43 0.46
44 0.43
45 0.41
46 0.37
47 0.33
48 0.3
49 0.27
50 0.27
51 0.24
52 0.21
53 0.18
54 0.13
55 0.13
56 0.18
57 0.19
58 0.21
59 0.25
60 0.28
61 0.3
62 0.35
63 0.35
64 0.31
65 0.31
66 0.32
67 0.31
68 0.33
69 0.31
70 0.27
71 0.24
72 0.23
73 0.22
74 0.17
75 0.15
76 0.1
77 0.11
78 0.11
79 0.13
80 0.13
81 0.13
82 0.13
83 0.12
84 0.11
85 0.12
86 0.1
87 0.09
88 0.07
89 0.07
90 0.06
91 0.07
92 0.07
93 0.07
94 0.07
95 0.07
96 0.07
97 0.08
98 0.08
99 0.11
100 0.2
101 0.21
102 0.21
103 0.23
104 0.23
105 0.23
106 0.28
107 0.28
108 0.25
109 0.26
110 0.29
111 0.3
112 0.34
113 0.35
114 0.34
115 0.36
116 0.34
117 0.31
118 0.28
119 0.33
120 0.29
121 0.27
122 0.26
123 0.22
124 0.2
125 0.21
126 0.2
127 0.17
128 0.25
129 0.32
130 0.37
131 0.44
132 0.48
133 0.57
134 0.66
135 0.69
136 0.63
137 0.6
138 0.61
139 0.6
140 0.58
141 0.53
142 0.47
143 0.44
144 0.44
145 0.4
146 0.35
147 0.28
148 0.25
149 0.21
150 0.19
151 0.15
152 0.13
153 0.13
154 0.11
155 0.1
156 0.09
157 0.1
158 0.11
159 0.12
160 0.14
161 0.16
162 0.18
163 0.18
164 0.2
165 0.21
166 0.22
167 0.25
168 0.3
169 0.31
170 0.3
171 0.3
172 0.28
173 0.32
174 0.36
175 0.32
176 0.27
177 0.24
178 0.23
179 0.24
180 0.24
181 0.2
182 0.15
183 0.16
184 0.24
185 0.27
186 0.31
187 0.35
188 0.44
189 0.53
190 0.62