Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8WFL3

Protein Details
Accession L8WFL3    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MAKSMRSKSKRAFRRTKREEGVYAHydrophilic
NLS Segment(s)
PositionSequence
7-17SKSKRAFRRTK
Subcellular Location(s) nucl 13mito 13mito_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSMRSKSKRAFRRTKREEGVYAAVHAARLERLSSKLAAKVSADKDGDQAMEKEDTEVQVQDGSEVRGLSFGTGVGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.88
4 0.85
5 0.81
6 0.73
7 0.67
8 0.61
9 0.5
10 0.42
11 0.32
12 0.25
13 0.2
14 0.17
15 0.12
16 0.07
17 0.07
18 0.07
19 0.07
20 0.09
21 0.1
22 0.12
23 0.13
24 0.15
25 0.15
26 0.15
27 0.14
28 0.18
29 0.18
30 0.21
31 0.21
32 0.18
33 0.19
34 0.18
35 0.18
36 0.14
37 0.13
38 0.1
39 0.11
40 0.11
41 0.11
42 0.11
43 0.12
44 0.12
45 0.12
46 0.1
47 0.1
48 0.1
49 0.1
50 0.11
51 0.11
52 0.11
53 0.11
54 0.11
55 0.1
56 0.1
57 0.09
58 0.09