Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8XAZ7

Protein Details
Accession L8XAZ7    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
171-199GRDGVSPTKRPRGRPKGSKNKPKVISDPTBasic
NLS Segment(s)
PositionSequence
177-193PTKRPRGRPKGSKNKPK
Subcellular Location(s) nucl 16.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR000116  HMGA  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Amino Acid Sequences MPKLKKNGLNLNVRAYSTNFGKLTRNGKSESALQREVNELKNKIKVITEGEYGAAKNEVEMIRKELGLSPLPSLQTTLEEKGARGFIPYTSVFGATDVGPSRTGSNHKRRLDQPDNETPTADAEIPATAPTSVIQSPQGNETIPDKRGPGRPRKVDTNGNLSLPGPPTEPGRDGVSPTKRPRGRPKGSKNKPKVISDPTSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.41
3 0.38
4 0.31
5 0.34
6 0.28
7 0.27
8 0.31
9 0.35
10 0.41
11 0.43
12 0.44
13 0.4
14 0.41
15 0.42
16 0.46
17 0.47
18 0.46
19 0.44
20 0.41
21 0.39
22 0.42
23 0.43
24 0.41
25 0.39
26 0.36
27 0.35
28 0.39
29 0.39
30 0.35
31 0.33
32 0.3
33 0.28
34 0.28
35 0.26
36 0.21
37 0.21
38 0.21
39 0.19
40 0.17
41 0.13
42 0.09
43 0.08
44 0.11
45 0.11
46 0.13
47 0.14
48 0.17
49 0.17
50 0.17
51 0.18
52 0.15
53 0.17
54 0.18
55 0.18
56 0.16
57 0.16
58 0.17
59 0.16
60 0.15
61 0.13
62 0.13
63 0.14
64 0.14
65 0.16
66 0.15
67 0.16
68 0.16
69 0.17
70 0.14
71 0.12
72 0.11
73 0.08
74 0.11
75 0.11
76 0.11
77 0.11
78 0.11
79 0.1
80 0.1
81 0.11
82 0.07
83 0.08
84 0.08
85 0.08
86 0.08
87 0.08
88 0.09
89 0.1
90 0.15
91 0.22
92 0.31
93 0.4
94 0.42
95 0.48
96 0.51
97 0.6
98 0.63
99 0.6
100 0.57
101 0.57
102 0.6
103 0.55
104 0.51
105 0.41
106 0.33
107 0.29
108 0.22
109 0.12
110 0.07
111 0.07
112 0.07
113 0.07
114 0.06
115 0.05
116 0.05
117 0.05
118 0.07
119 0.08
120 0.08
121 0.11
122 0.12
123 0.13
124 0.15
125 0.15
126 0.13
127 0.14
128 0.17
129 0.19
130 0.19
131 0.19
132 0.19
133 0.23
134 0.31
135 0.38
136 0.45
137 0.51
138 0.58
139 0.62
140 0.69
141 0.7
142 0.71
143 0.68
144 0.65
145 0.58
146 0.5
147 0.45
148 0.37
149 0.33
150 0.26
151 0.23
152 0.16
153 0.15
154 0.17
155 0.2
156 0.21
157 0.2
158 0.23
159 0.23
160 0.25
161 0.33
162 0.38
163 0.44
164 0.49
165 0.57
166 0.58
167 0.66
168 0.73
169 0.76
170 0.78
171 0.81
172 0.85
173 0.86
174 0.93
175 0.95
176 0.93
177 0.92
178 0.89
179 0.85
180 0.82
181 0.79