Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8WFY1

Protein Details
Accession L8WFY1    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
34-64TPSDCRYATRCIRKWRKHPRLRLSCGVRRASHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 6, cyto 4
Family & Domain DBs
Amino Acid Sequences MQPARRPSITRSKGLVLDISLPVVCPEPLCYRATPSDCRYATRCIRKWRKHPRLRLSCGVRRASY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.39
3 0.29
4 0.26
5 0.21
6 0.18
7 0.14
8 0.12
9 0.11
10 0.1
11 0.09
12 0.06
13 0.09
14 0.11
15 0.14
16 0.15
17 0.15
18 0.17
19 0.2
20 0.24
21 0.25
22 0.25
23 0.32
24 0.31
25 0.33
26 0.34
27 0.38
28 0.43
29 0.48
30 0.52
31 0.55
32 0.66
33 0.72
34 0.81
35 0.85
36 0.87
37 0.87
38 0.91
39 0.91
40 0.91
41 0.9
42 0.89
43 0.87
44 0.83
45 0.82