Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8WYR7

Protein Details
Accession L8WYR7    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
47-68KKDIDQRRKLHHRKPARTTEIKBasic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 9, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR031833  DUF4748  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF15932  DUF4748  
Amino Acid Sequences MYHVEWTAHNLTLTTTTTTTTMNNPRSMVASWAVLLVGGGITFYFVKKDIDQRRKLHHRKPARTTEIKDCEYTSDKRSTGTSDKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.13
4 0.14
5 0.15
6 0.15
7 0.19
8 0.26
9 0.28
10 0.29
11 0.29
12 0.29
13 0.3
14 0.29
15 0.24
16 0.17
17 0.14
18 0.12
19 0.11
20 0.1
21 0.08
22 0.07
23 0.04
24 0.03
25 0.02
26 0.02
27 0.02
28 0.03
29 0.03
30 0.03
31 0.04
32 0.05
33 0.06
34 0.08
35 0.17
36 0.27
37 0.36
38 0.44
39 0.49
40 0.58
41 0.68
42 0.76
43 0.75
44 0.75
45 0.76
46 0.78
47 0.82
48 0.83
49 0.81
50 0.8
51 0.77
52 0.78
53 0.75
54 0.67
55 0.6
56 0.5
57 0.46
58 0.43
59 0.42
60 0.36
61 0.35
62 0.33
63 0.33
64 0.34
65 0.36