Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4RCR9

Protein Details
Accession F4RCR9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23KIPWRLSSTRKANVRKRLREVDSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25.5, mito_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
KEGG mlr:MELLADRAFT_34098  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences KIPWRLSSTRKANVRKRLREVDSVISAVKESGIQCQALTKALELPTEAEMTPKDKYFVFSANSKGYRKGIHKVPHFTKVTHRVNPKGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.82
4 0.82
5 0.78
6 0.75
7 0.7
8 0.65
9 0.56
10 0.48
11 0.39
12 0.3
13 0.25
14 0.18
15 0.14
16 0.1
17 0.08
18 0.1
19 0.11
20 0.11
21 0.11
22 0.12
23 0.13
24 0.13
25 0.13
26 0.09
27 0.11
28 0.11
29 0.12
30 0.1
31 0.11
32 0.1
33 0.11
34 0.1
35 0.08
36 0.08
37 0.1
38 0.12
39 0.11
40 0.11
41 0.1
42 0.12
43 0.14
44 0.17
45 0.17
46 0.19
47 0.23
48 0.28
49 0.32
50 0.32
51 0.33
52 0.32
53 0.36
54 0.37
55 0.4
56 0.42
57 0.47
58 0.54
59 0.6
60 0.63
61 0.66
62 0.64
63 0.59
64 0.6
65 0.62
66 0.62
67 0.61
68 0.64