Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8WPP4

Protein Details
Accession L8WPP4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
39-58VTARRRPRGRWPGHPRLRPSBasic
NLS Segment(s)
PositionSequence
41-62ARRRPRGRWPGHPRLRPSGSKA
Subcellular Location(s) mito 11cyto 11cyto_mito 11
Family & Domain DBs
Amino Acid Sequences MSNLCTFHDLPGTSHCLTYASVAVGDVWVLYAVQEGKPVTARRRPRGRWPGHPRLRPSGSKAWGGREPHMDEYVTNRCVII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.19
4 0.18
5 0.18
6 0.15
7 0.1
8 0.09
9 0.09
10 0.09
11 0.07
12 0.07
13 0.05
14 0.04
15 0.03
16 0.03
17 0.03
18 0.04
19 0.05
20 0.05
21 0.07
22 0.07
23 0.08
24 0.11
25 0.14
26 0.18
27 0.24
28 0.31
29 0.39
30 0.48
31 0.52
32 0.59
33 0.67
34 0.69
35 0.73
36 0.76
37 0.78
38 0.78
39 0.81
40 0.75
41 0.73
42 0.72
43 0.64
44 0.61
45 0.58
46 0.52
47 0.53
48 0.5
49 0.47
50 0.47
51 0.48
52 0.45
53 0.42
54 0.43
55 0.4
56 0.4
57 0.34
58 0.29
59 0.32
60 0.36
61 0.3