Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8XB14

Protein Details
Accession L8XB14    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
132-156RQFYTMRLTEHRRRRQQKEVDALAPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, mito_nucl 11.999, cyto_mito 11.666, nucl 5, cyto_nucl 4.999
Family & Domain DBs
InterPro View protein in InterPro  
IPR013640  Vfa1  
Pfam View protein in Pfam  
PF08432  Vfa1  
Amino Acid Sequences MSAPFLNVYYKRRLQGHGAYICNKPTTIVLSTQPVLDFIYTCDSHLSDPGFATLQAPAVSPTPSASTEEIAKIKAEWEQEQAEKEKKDEGDKKDEKKDEEKEKAVSSPKPSSPAPVAGGSTTPKHDKYVLHRQFYTMRLTEHRRRRQQKEVDALAPKLSGAGLSVPKQMG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.51
3 0.56
4 0.55
5 0.54
6 0.52
7 0.51
8 0.5
9 0.44
10 0.36
11 0.27
12 0.22
13 0.21
14 0.19
15 0.19
16 0.19
17 0.23
18 0.23
19 0.23
20 0.22
21 0.18
22 0.17
23 0.14
24 0.12
25 0.09
26 0.14
27 0.13
28 0.13
29 0.14
30 0.14
31 0.14
32 0.16
33 0.16
34 0.11
35 0.11
36 0.12
37 0.11
38 0.11
39 0.11
40 0.08
41 0.08
42 0.08
43 0.08
44 0.08
45 0.08
46 0.09
47 0.08
48 0.09
49 0.09
50 0.1
51 0.12
52 0.12
53 0.12
54 0.12
55 0.15
56 0.15
57 0.13
58 0.13
59 0.1
60 0.1
61 0.12
62 0.12
63 0.11
64 0.13
65 0.15
66 0.16
67 0.18
68 0.2
69 0.22
70 0.2
71 0.2
72 0.2
73 0.19
74 0.26
75 0.31
76 0.32
77 0.39
78 0.45
79 0.5
80 0.55
81 0.57
82 0.53
83 0.53
84 0.57
85 0.55
86 0.54
87 0.52
88 0.46
89 0.44
90 0.45
91 0.42
92 0.37
93 0.34
94 0.34
95 0.32
96 0.34
97 0.33
98 0.33
99 0.31
100 0.3
101 0.27
102 0.23
103 0.22
104 0.18
105 0.19
106 0.17
107 0.17
108 0.17
109 0.18
110 0.18
111 0.19
112 0.22
113 0.25
114 0.31
115 0.41
116 0.46
117 0.48
118 0.48
119 0.49
120 0.5
121 0.49
122 0.46
123 0.37
124 0.32
125 0.33
126 0.42
127 0.48
128 0.54
129 0.62
130 0.67
131 0.75
132 0.8
133 0.84
134 0.85
135 0.85
136 0.85
137 0.8
138 0.77
139 0.72
140 0.65
141 0.55
142 0.45
143 0.35
144 0.25
145 0.19
146 0.12
147 0.08
148 0.11
149 0.14
150 0.16