Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8X9Z3

Protein Details
Accession L8X9Z3    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
34-58SASPAPRARSPPRRRSPPPRPRGIPHydrophilic
NLS Segment(s)
PositionSequence
25-56SGRGRDRSRSASPAPRARSPPRRRSPPPRPRG
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
Amino Acid Sequences MYDNNTPADPYADSSYPPPDSRNGSGRGRDRSRSASPAPRARSPPRRRSPPPRPRGIPNAQPSSVLGVFGLSIRTQERDLDEEFSRYGKVEKSDRSRGFGFIKMSTTDEAARCIAELNGSQRSTNSC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.25
3 0.26
4 0.26
5 0.25
6 0.24
7 0.3
8 0.33
9 0.37
10 0.38
11 0.4
12 0.46
13 0.51
14 0.56
15 0.55
16 0.54
17 0.53
18 0.54
19 0.53
20 0.51
21 0.5
22 0.5
23 0.53
24 0.57
25 0.57
26 0.56
27 0.58
28 0.62
29 0.67
30 0.68
31 0.71
32 0.72
33 0.77
34 0.8
35 0.84
36 0.86
37 0.86
38 0.85
39 0.83
40 0.77
41 0.73
42 0.74
43 0.69
44 0.66
45 0.62
46 0.58
47 0.49
48 0.45
49 0.4
50 0.34
51 0.28
52 0.2
53 0.12
54 0.08
55 0.07
56 0.07
57 0.08
58 0.04
59 0.05
60 0.06
61 0.07
62 0.08
63 0.09
64 0.1
65 0.13
66 0.14
67 0.17
68 0.17
69 0.17
70 0.17
71 0.16
72 0.15
73 0.13
74 0.13
75 0.12
76 0.16
77 0.21
78 0.28
79 0.35
80 0.45
81 0.47
82 0.5
83 0.49
84 0.49
85 0.46
86 0.43
87 0.38
88 0.29
89 0.3
90 0.26
91 0.27
92 0.24
93 0.22
94 0.22
95 0.19
96 0.2
97 0.18
98 0.17
99 0.15
100 0.15
101 0.13
102 0.12
103 0.14
104 0.16
105 0.22
106 0.23
107 0.24