Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8WT76

Protein Details
Accession L8WT76    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
21-44DSDNPVRKKDPRMTTNKKKATNFFHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 8, nucl 7.5, cyto 7.5, plas 5, pero 3, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039961  Nuo9.5  
CDD cd22903  NI9M  
Amino Acid Sequences MFEVQSNTFMLAPAPVHEENDSDNPVRKKDPRMTTNKKKATNFFTTANVKNRNRDRNTPKAPGSKAAVSLQLKAARGGKGNTCVSALMCVDPDLQTPILTVDQSHTAHTKMSFVTNTFRYLRHQAHENPTIVWSIAIGAAGPLAVVVVPPVRRRFGWVPDERIPTSYPLPNRARSTVTGYDDPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.17
4 0.17
5 0.18
6 0.2
7 0.23
8 0.26
9 0.22
10 0.28
11 0.29
12 0.32
13 0.38
14 0.39
15 0.44
16 0.5
17 0.58
18 0.61
19 0.69
20 0.77
21 0.81
22 0.87
23 0.87
24 0.85
25 0.81
26 0.78
27 0.75
28 0.72
29 0.65
30 0.56
31 0.54
32 0.52
33 0.52
34 0.53
35 0.55
36 0.5
37 0.55
38 0.61
39 0.65
40 0.64
41 0.69
42 0.69
43 0.7
44 0.75
45 0.73
46 0.7
47 0.68
48 0.64
49 0.57
50 0.53
51 0.44
52 0.39
53 0.33
54 0.34
55 0.27
56 0.26
57 0.26
58 0.25
59 0.23
60 0.23
61 0.24
62 0.18
63 0.2
64 0.2
65 0.18
66 0.21
67 0.22
68 0.2
69 0.18
70 0.17
71 0.15
72 0.15
73 0.13
74 0.07
75 0.07
76 0.07
77 0.07
78 0.07
79 0.07
80 0.07
81 0.07
82 0.06
83 0.06
84 0.07
85 0.07
86 0.07
87 0.06
88 0.06
89 0.1
90 0.11
91 0.12
92 0.12
93 0.12
94 0.13
95 0.13
96 0.14
97 0.1
98 0.12
99 0.12
100 0.12
101 0.17
102 0.17
103 0.2
104 0.2
105 0.21
106 0.23
107 0.29
108 0.3
109 0.29
110 0.34
111 0.36
112 0.42
113 0.47
114 0.43
115 0.37
116 0.35
117 0.32
118 0.26
119 0.2
120 0.12
121 0.07
122 0.06
123 0.06
124 0.05
125 0.04
126 0.03
127 0.03
128 0.03
129 0.02
130 0.02
131 0.02
132 0.02
133 0.03
134 0.06
135 0.09
136 0.14
137 0.17
138 0.2
139 0.21
140 0.28
141 0.33
142 0.38
143 0.46
144 0.48
145 0.53
146 0.58
147 0.64
148 0.57
149 0.54
150 0.47
151 0.41
152 0.39
153 0.37
154 0.34
155 0.37
156 0.42
157 0.47
158 0.51
159 0.51
160 0.5
161 0.47
162 0.51
163 0.49
164 0.49